PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00001521-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 149aa MW: 16309.7 Da PI: 6.0952 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 52.3 | 1.8e-16 | 99 | 136 | 1 | 39 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpyl 39 +ep+YVNaKQy++Il+RRq+Rak+e+e+kl +k+rk + PSME_00001521-RA 99 EEPVYVNAKQYRGILRRRQSRAKAESENKL-IKNRKAIF 136 69****************************.99999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 6.1E-9 | 97 | 146 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 16.864 | 98 | 149 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.3E-11 | 100 | 134 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 103 | 123 | IPR018362 | CCAAT-binding factor, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MGSIDDSAPD EQQPQVDSVQ QEAPPPGMIP PPAMTLLPPE FVMPHTQLEL GQAMVRPAYP 60 YPDPYFGGIV AAYGPQAVIH PHMLGVPHAG VPLPSDAIEE PVYVNAKQYR GILRRRQSRA 120 KAESENKLIK NRKAIFYIRD GAISLDGSM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT104418 | 1e-169 | BT104418.1 Picea glauca clone GQ02810_C14 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020268977.1 | 6e-47 | nuclear transcription factor Y subunit A-7 isoform X2 | ||||
Refseq | XP_024380415.1 | 7e-47 | nuclear transcription factor Y subunit A-7-like | ||||
Refseq | XP_024380416.1 | 7e-47 | nuclear transcription factor Y subunit A-7-like | ||||
Swissprot | Q84JP1 | 2e-25 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A2K1KAU8 | 2e-45 | A0A2K1KAU8_PHYPA; Uncharacterized protein | ||||
TrEMBL | A9S234 | 2e-43 | A9S234_PHYPA; Predicted protein | ||||
STRING | PP1S42_174V6.1 | 3e-46 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 5e-28 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|