PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03187g02004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 542aa    MW: 60153.7 Da    PI: 5.0627
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03187g02004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS423.71.5e-1291735422374
                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                               +elLl+cA avs++  ++a++l++ l+e +s +g+pmqRl ay++e+L+arl++s+s +yk+l+++e +   sse +++++++++
  Peinf101Scf03187g02004.1 173 KELLLACAGAVSDDAISAAEKLMNVLEEKVSVSGEPMQRLSAYMLEGLRARLYSSGSIIYKKLKCNEPT---SSELFSYMQVLYH 254
                               689*****************************************************************9...9************ PP

                      GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfA 169
                               ++P+ kf++  aN  I ea+ +e+r+H+iDf i qG+QW+ L+q+La Rp+gpp l iTgv++++s   +   l+ +gerLak+A
  Peinf101Scf03187g02004.1 255 ICPYTKFAYTSANVVIEEAMRNENRIHVIDFTIAQGTQWMFLMQSLARRPGGPPFLHITGVDDSQSAhaRGGGLQLVGERLAKVA 339
                               ***************************************************************9988889999************ PP

                      GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                               e++gvpfef++ +a +  d++le+L +++gEalaVn+ + lh+++desvs+e++rd++L+lvkslsPk+v++veqe+++n++ Fl
  Peinf101Scf03187g02004.1 340 ESCGVPFEFHA-AALSGCDVQLENLCIRHGEALAVNFPYVLHHMPDESVSTENHRDRLLRLVKSLSPKIVTLVEQESNTNTAAFL 423
                               ***********.899********************************************************************** PP

                      GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                                rf e+l+yy+a+f+s++a+ p ++++ri+ E+ +++r+ivn++acega+r+erhe ++kW++r+++aGF+p pls ++ + +k 
  Peinf101Scf03187g02004.1 424 PRFRETLDYYTAMFESIDAGRPGDDKQRISAEENCVARDIVNIIACEGADRVERHELFGKWSMRFMMAGFSPCPLSPSVGEAIKD 508
                               ************************************************************************************* PP

                      GRAS 340 llrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +l++++ + +r+ e++g+l+lgWk+r+L ++SaWr
  Peinf101Scf03187g02004.1 509 MLKEYSPN-FRLAESNGALYLGWKNRALATTSAWR 542
                               ******55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.878146523IPR005202Transcription factor GRAS
PfamPF035145.1E-127173542IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MQASQRPQTS GSVHKLYHQP MKKVEQYYSP YHVFNNICND TSSSGTQVSF QAQNEQFFTL  60
DSLPAADYVI YDSTPAVSAS SNWSPFSPQC SQSYISDLHS SENTYGSPLS GCSGVDDGNE  120
LKHVLWEMAN NLLGPESDMD DDSSCSFNDV VSEPSSLTKW NRVLDIASSM DVKELLLACA  180
GAVSDDAISA AEKLMNVLEE KVSVSGEPMQ RLSAYMLEGL RARLYSSGSI IYKKLKCNEP  240
TSSELFSYMQ VLYHICPYTK FAYTSANVVI EEAMRNENRI HVIDFTIAQG TQWMFLMQSL  300
ARRPGGPPFL HITGVDDSQS AHARGGGLQL VGERLAKVAE SCGVPFEFHA AALSGCDVQL  360
ENLCIRHGEA LAVNFPYVLH HMPDESVSTE NHRDRLLRLV KSLSPKIVTL VEQESNTNTA  420
AFLPRFRETL DYYTAMFESI DAGRPGDDKQ RISAEENCVA RDIVNIIACE GADRVERHEL  480
FGKWSMRFMM AGFSPCPLSP SVGEAIKDML KEYSPNFRLA ESNGALYLGW KNRALATTSA  540
WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-5817954126378Protein SCARECROW
5b3h_A2e-5817954125377Protein SCARECROW
5b3h_D2e-5817954125377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016554161.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_016554162.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_016554163.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A2G3CJ540.0A0A2G3CJ54_CAPCH; Scarecrow-like protein 5
STRINGXP_009625296.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13