PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03171g03003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 533aa    MW: 59252.1 Da    PI: 6.5086
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03171g03003.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS459.52e-1401635331374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               l+++L++cA+avs+gdl  aq l+++l++++s +g+p+qRl ay++e+L arla s+s+++k+l+++e +   s e l+++++++
  Peinf101Scf03171g03003.1 163 LKHVLIACAKAVSDGDLLTAQLLISELRQMVSVSGEPIQRLGAYILEGLVARLAASGSSICKSLRCKEPA---SFELLSYMHVLY 244
                               689******************************************************************9...9*********** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakf 168
                               e++P++kf+++ aN aI ea++ e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg+++++s   +   l+ +g+rL+k+
  Peinf101Scf03171g03003.1 245 EICPYFKFGYMSANGAIAEAMKDENRVHIIDFQITQGSQWVTLIQAFAARPGGPPHIRITGIDDSTSAyaRGGGLNIVGQRLSKL 329
                               ****************************************************************998899999************ PP

                      GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                               Ae+++vpfef++ +a + +d+++e+L ++pgEalaVn+++ lh+++desvs+e++rd++L++vk+l+Pkvv++veqe+++n++ F
  Peinf101Scf03171g03003.1 330 AEAFKVPFEFHA-AAMSGSDVQPENLGIRPGEALAVNFAFTLHHMPDESVSTENHRDRLLRMVKNLNPKVVTLVEQESNTNTAAF 413
                               ************.899********************************************************************* PP

                      GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                               + rfle+l+yy+a+f+s++++lpr+++eri+vE+++l+r++vn++aceg er+erhe l+kW++r+++aGF+p+pls+ +++++k
  Peinf101Scf03171g03003.1 414 FPRFLETLDYYTAMFESIDMTLPRAHKERINVEQHCLARDVVNIIACEGIERVERHELLGKWKSRFRMAGFSPYPLSSLVNATIK 498
                               ************************************************************************************* PP

                      GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +ll+ +++  yr+ee++g+l+lgW++r Lv+ +aW+
  Peinf101Scf03171g03003.1 499 TLLESYSD-KYRLEERDGALYLGWMNRDLVASCAWK 533
                               *******5.5*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098571.496137514IPR005202Transcription factor GRAS
PfamPF035147.0E-138163533IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MQASQRIRRS AMSNTLYYQP VQKAEPYCLP QFQSLDNHLS YINGSHGGNN SFQTATGSYA  60
SHHSPATASF SSNGSPICHQ ESQSNLSDAR KSPDTNYGSP ISGSCITDDV NDFMSKLKEL  120
ETVMLGPDSD FLESYDNSLP SSIASPEINS WRQMMEATPR RDLKHVLIAC AKAVSDGDLL  180
TAQLLISELR QMVSVSGEPI QRLGAYILEG LVARLAASGS SICKSLRCKE PASFELLSYM  240
HVLYEICPYF KFGYMSANGA IAEAMKDENR VHIIDFQITQ GSQWVTLIQA FAARPGGPPH  300
IRITGIDDST SAYARGGGLN IVGQRLSKLA EAFKVPFEFH AAAMSGSDVQ PENLGIRPGE  360
ALAVNFAFTL HHMPDESVST ENHRDRLLRM VKNLNPKVVT LVEQESNTNT AAFFPRFLET  420
LDYYTAMFES IDMTLPRAHK ERINVEQHCL ARDVVNIIAC EGIERVERHE LLGKWKSRFR  480
MAGFSPYPLS SLVNATIKTL LESYSDKYRL EERDGALYLG WMNRDLVASC AWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6017053226378Protein SCARECROW
5b3h_A2e-6017053225377Protein SCARECROW
5b3h_D2e-6017053225377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019250098.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_019250099.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A1J6I6W30.0A0A1J6I6W3_NICAT; Scarecrow-like transcription factor pat1
STRINGXP_009784447.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]