PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf03005g04018.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 113aa MW: 12997.8 Da PI: 4.2159 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 32.1 | 2.7e-10 | 12 | 41 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 rg W +eEd++l+++v+ +G g+W+tI+++ Peinf101Scf03005g04018.1 12 RGFWKPEEDLILKNCVETHGEGNWATISEK 41 799************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.078 | 7 | 52 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.2E-8 | 7 | 41 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 6.1E-11 | 7 | 41 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.7E-7 | 12 | 41 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.63E-6 | 15 | 55 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MKDQEVKARM KRGFWKPEED LILKNCVETH GEGNWATISE KSARNQEVAT KTVLDSWIEE 60 MQDFNCSLLS PLPMNNVAFL QDEPFLPILD DIVLLEAFTS TGKEVWPDIQ PFL |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF122054 | 2e-75 | AF122054.1 Solanum tuberosum clone 9 tuber-specific and sucrose-responsive element binding factor (TSF) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001275316.1 | 7e-37 | transcription factor MYB82-like | ||||
TrEMBL | Q9FZ12 | 2e-35 | Q9FZ12_SOLTU; Tuber-specific and sucrose-responsive element binding factor | ||||
STRING | PGSC0003DMT400079416 | 3e-36 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G52600.1 | 1e-14 | myb domain protein 82 |