![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf02920g02049.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 209aa MW: 24746.7 Da PI: 9.6288 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.4 | 3.3e-18 | 4 | 49 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+++G+++W++Ia+ ++ gR++k+c++rw++ Peinf101Scf02920g02049.1 4 RGHWRPHEDEKLQELVAKYGPHNWNAIAENLQ-GRSGKSCRLRWYNQ 49 899*****************************.************96 PP | |||||||
2 | Myb_DNA-binding | 54.8 | 2.1e-17 | 56 | 99 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eE+e+l+ ++ +G++ W+ Iar ++ gRt++ +k++w+ Peinf101Scf02920g02049.1 56 RSPFTEEEEERLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99 789*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.791 | 1 | 50 | IPR017930 | Myb domain |
SMART | SM00717 | 4.9E-16 | 3 | 52 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.57E-29 | 4 | 97 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.0E-17 | 4 | 50 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.4E-27 | 5 | 57 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.71E-14 | 7 | 48 | No hit | No description |
PROSITE profile | PS51294 | 26.112 | 51 | 105 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-15 | 55 | 103 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-14 | 56 | 98 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.65E-11 | 58 | 98 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.0E-21 | 58 | 104 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MCSRGHWRPH EDEKLQELVA KYGPHNWNAI AENLQGRSGK SCRLRWYNQL DPRINRSPFT 60 EEEEERLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MSRRCRERSK IYSMRNINNA 120 AQKSLTSQQD TSQNQDDNIQ DIRRGSSNMN SIDQQFLERF NYYPNFTFNN SLYPKELHFD 180 HLRHHLKINE GIYTHETAQP GVLLSVAIL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 9e-35 | 4 | 105 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975442 | 1e-66 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. | |||
GenBank | HG975515 | 1e-66 | HG975515.1 Solanum lycopersicum chromosome ch03, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009616250.1 | 1e-108 | PREDICTED: transcriptional activator Myb-like | ||||
Refseq | XP_016466774.1 | 1e-108 | PREDICTED: transcriptional activator Myb-like | ||||
Refseq | XP_018630632.1 | 1e-108 | PREDICTED: transcriptional activator Myb-like | ||||
Swissprot | Q6R0C4 | 6e-69 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A1S3ZR42 | 1e-107 | A0A1S3ZR42_TOBAC; transcriptional activator Myb-like | ||||
STRING | XP_009616250.1 | 1e-107 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1784 | 24 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 8e-71 | myb domain protein 52 |
Publications ? help Back to Top | |||
---|---|---|---|
|