PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf02339g10011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 139aa MW: 15744.7 Da PI: 5.0732 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 169.4 | 4.2e-53 | 19 | 114 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 reqdr+lPianv+rimk +lP nakisk+aket+qecvsefi+fvtseasdkc++e+rkt+ngdd++wal+tlGf+dy +lk y Peinf101Scf02339g10011.1 19 REQDRLLPIANVGRIMKTILPPNAKISKEAKETMQECVSEFIAFVTSEASDKCRKERRKTVNGDDVCWALGTLGFDDYSGALKRY 103 89*********************************************************************************** PP NF-YB 87 lkkyrelegek 97 l++yre+egek Peinf101Scf02339g10011.1 104 LHRYREMEGEK 114 *********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-51 | 16 | 132 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.54E-39 | 21 | 124 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.7E-26 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.2E-16 | 52 | 70 | No hit | No description |
PRINTS | PR00615 | 2.2E-16 | 71 | 89 | No hit | No description |
PRINTS | PR00615 | 2.2E-16 | 90 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MAHQNMGASS SNDEVGVSRE QDRLLPIANV GRIMKTILPP NAKISKEAKE TMQECVSEFI 60 AFVTSEASDK CRKERRKTVN GDDVCWALGT LGFDDYSGAL KRYLHRYREM EGEKVNQERV 120 SNSEELMEEP AAQPRNYID |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-43 | 19 | 109 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-43 | 19 | 109 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975513 | 1e-92 | HG975513.1 Solanum lycopersicum chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006342784.1 | 1e-77 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 8e-58 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | M1C2L2 | 3e-76 | M1C2L2_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400058414 | 5e-77 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-60 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|