PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02272g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family MYB
Protein Properties Length: 589aa    MW: 66536.1 Da    PI: 9.6615
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02272g00040.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.18.2e-082569345
                              SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
           Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                              +WT+ E + + +a +++ ++   +W ++a++++ g+t  +++  + 
  Peinf101Scf02272g00040.1 25 KWTPAENKAFENALALFDKDtpdRWQKVAEMVP-GKTVVDVIKQYK 69
                              8********************************.******998876 PP

2Myb_DNA-binding43.85.7e-14133177347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  Peinf101Scf02272g00040.1 133 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 177
                               7*****************************99************9 PP

3Myb_DNA-binding24.18.2e-08313357345
                               SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 
                               +WT+ E + + +a +++ ++   +W ++a++++ g+t  +++  + 
  Peinf101Scf02272g00040.1 313 KWTPAENKAFENALALFDKDtpdRWQKVAEMVP-GKTVVDVIKQYK 357
                               8********************************.******998876 PP

4Myb_DNA-binding43.85.7e-14421465347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  Peinf101Scf02272g00040.1 421 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 465
                               7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-41669IPR009057Homeodomain-like
PROSITE profilePS512938.9012174IPR017884SANT domain
SMARTSM007172.7E-102274IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-112479IPR009057Homeodomain-like
PfamPF002497.8E-72570IPR001005SANT/Myb domain
CDDcd001674.55E-72571No hitNo description
PROSITE profilePS5129419.663126182IPR017930Myb domain
SuperFamilySSF466891.87E-16127181IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-17129181IPR006447Myb domain, plants
SMARTSM007172.9E-12130180IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-12131177IPR009057Homeodomain-like
PfamPF002492.4E-12133177IPR001005SANT/Myb domain
CDDcd001671.42E-10133178No hitNo description
Gene3DG3DSA:1.10.10.607.7E-4304357IPR009057Homeodomain-like
PROSITE profilePS512938.901309362IPR017884SANT domain
SMARTSM007172.7E-10310362IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-11312367IPR009057Homeodomain-like
PfamPF002497.8E-7313358IPR001005SANT/Myb domain
CDDcd001674.55E-7313359No hitNo description
PROSITE profilePS5129419.663414470IPR017930Myb domain
SuperFamilySSF466891.87E-16415469IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-17417469IPR006447Myb domain, plants
SMARTSM007172.9E-12418468IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-12419465IPR009057Homeodomain-like
PfamPF002492.4E-12421465IPR001005SANT/Myb domain
CDDcd001671.42E-10421466No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MEILSPSPYI SNSSWFLDEN SKSTKWTPAE NKAFENALAL FDKDTPDRWQ KVAEMVPGKT  60
VVDVIKQYKE LEDDVSRIEA GLISIPGYGT TSPFTLEWGN SHSFDEYKQS YVVGGKRSLS  120
NRPQEQERKK GIPWTEEEHK LFLMGLKKYG KGDWRNISRN FVITRTPTQV ASHAQKYFIR  180
QLSGGKDKRR ASIHDITTIN LNDNQTSSPD HQTPASLDQS NVISQQAKSA SNAMHKMPFQ  240
WTQANNGFNS AQGSLFMSPP YGGNSYGNTK MQSQSLQRGA LPMHESYFGS QSMNFQLQSA  300
QHWFLDENSK STKWTPAENK AFENALALFD KDTPDRWQKV AEMVPGKTVV DVIKQYKELE  360
DDVSRIEAGL ISIPGYGTTS PFTLEWGNSH SFDEYKQSYV VGGKRSLSNR PQEQERKKGI  420
PWTEEEHKLF LMGLKKYGKG DWRNISRNFV ITRTPTQVAS HAQKYFIRQL SGGKDKRRAS  480
IHDITTINLN DNQTSSPDHQ TPASLDQSNV ISQQAKSASN AMHKMPFQWT QANNGFNSAQ  540
GSLFMSPPYG GNSYGNTKMQ SQSLQRGALP MHESYFGSQS MNFQLQSAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-14263791176RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603384.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_009603385.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016432478.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-142DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1S3WXT50.0A0A1S3WXT5_TOBAC; transcription factor DIVARICATA-like
STRINGXP_009603384.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.15e-97Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]