PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02160g01026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family MYB
Protein Properties Length: 403aa    MW: 47113 Da    PI: 5.6497
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02160g01026.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-17188234148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                               +g WT eEd ll+++v+++G + W+ Ia+++  gR +kqc++rw+++l
  Peinf101Scf02160g01026.1 188 KGQWTIEEDRLLIHLVEKFGVRKWSQIAQMLK-GRIGKQCRERWYNHL 234
                               799****************************9.*************97 PP

2Myb_DNA-binding56.37.3e-18242282345
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                WT+eEd +l++a+++ G++ W+ Ia++++ gRt++++k++w+
  Peinf101Scf02160g01026.1 242 LWTEEEDRILIEAHAEVGNK-WTEIAKRLP-GRTENSIKNHWN 282
                               6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.716183238IPR017930Myb domain
SMARTSM007174.0E-16187236IPR001005SANT/Myb domain
SuperFamilySSF466899.71E-32188281IPR009057Homeodomain-like
PfamPF002491.6E-16188234IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-23189237IPR009057Homeodomain-like
CDDcd001674.31E-14191234No hitNo description
Gene3DG3DSA:1.10.10.603.0E-23238288IPR009057Homeodomain-like
PROSITE profilePS5129422.828239289IPR017930Myb domain
SMARTSM007171.2E-17239287IPR001005SANT/Myb domain
PfamPF002491.3E-16242282IPR001005SANT/Myb domain
CDDcd001672.88E-13243285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MEFDHSSNQN LSIQPYNNSL IREEMDDVFC TVSKDYLQDF HHLDLTFNNP HDNLLIETNG  60
YDSLFDPILN EDNLSSLDHQ DFNLNYEFKP FEQNSASGSS TLVMKNFENS MDMHTSNENL  120
LSLCSEDMKP LSFVNVQDES SCITADNNYY DNKICRRKKN KKVNSKENIL SPCMGKLGKG  180
KKKSKSAKGQ WTIEEDRLLI HLVEKFGVRK WSQIAQMLKG RIGKQCRERW YNHLRPDIKK  240
DLWTEEEDRI LIEAHAEVGN KWTEIAKRLP GRTENSIKNH WNATKRRQFS RRKCRTKWPR  300
PSCLLQNYIK SLNFEKSIRS SHDTTINAPK QEPFGIPDYD LTSEVPEFAF DDKLFDENIS  360
MDALMDQIHD RCLDLEIPYD ELPKLMQGDA NKEPDLIDLI SEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C7e-441882884104C-Myb DNA-Binding Domain
1msf_C7e-441882884104C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016469577.11e-164PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L23e-79MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A1S3ZYR71e-163A0A1S3ZYR7_TOBAC; transcription factor MYB98-like
STRINGXP_009595322.11e-148(Nicotiana tomentosiformis)
STRINGXP_009603629.11e-147(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-77myb domain protein 98
Publications ? help Back to Top
  1. Mendes MA, et al.
    Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis.
    Development, 2016. 143(15): p. 2780-90
    [PMID:27338615]