PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf02070g00009.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 60aa MW: 6995.11 Da PI: 10.2914 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.2 | 1.6e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs++g++yeys+ Peinf101Scf02070g00009.1 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSN 59 79***********************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.011 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.2E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.4E-29 | 2 | 59 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.23E-36 | 2 | 60 | No hit | No description |
PRINTS | PR00404 | 1.5E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 60 aa Download sequence Send to blast |
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFST RGRVYEYSNN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development. {ECO:0000269|PubMed:29853599}. | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | X81651 | 7e-77 | X81651.1 P.hybrida mRNA for MADS box containing protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016582207.1 | 6e-36 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 | ||||
Swissprot | A0A217EJJ0 | 6e-35 | AG11S_VITVI; Agamous-like MADS-box protein AGL11 | ||||
Swissprot | F6I457 | 7e-35 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A1U8HFL2 | 1e-34 | A0A1U8HFL2_CAPAN; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A0A2G3AJX1 | 1e-34 | A0A2G3AJX1_CAPAN; agamous-like MADS-box protein AGL11 isoform X1 | ||||
STRING | PGSC0003DMT400013248 | 3e-35 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.2 | 3e-37 | MIKC_MADS family protein |