PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02070g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 60aa    MW: 6995.11 Da    PI: 10.2914
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02070g00009.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.21.6e-31959151
                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                              krien++nrqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs++g++yeys+
  Peinf101Scf02070g00009.1  9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSN 59
                              79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.011160IPR002100Transcription factor, MADS-box
SMARTSM004327.2E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-29259IPR002100Transcription factor, MADS-box
CDDcd002651.23E-36260No hitNo description
PRINTSPR004041.5E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFST RGRVYEYSNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-20160160Myocyte-specific enhancer factor 2B
1tqe_Q1e-20160160Myocyte-specific enhancer factor 2B
1tqe_R1e-20160160Myocyte-specific enhancer factor 2B
1tqe_S1e-20160160Myocyte-specific enhancer factor 2B
6c9l_A1e-20160160Myocyte-specific enhancer factor 2B
6c9l_B1e-20160160Myocyte-specific enhancer factor 2B
6c9l_C1e-20160160Myocyte-specific enhancer factor 2B
6c9l_D1e-20160160Myocyte-specific enhancer factor 2B
6c9l_E1e-20160160Myocyte-specific enhancer factor 2B
6c9l_F1e-20160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in seed development. {ECO:0000269|PubMed:29853599}.
UniProtProbable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX816517e-77X81651.1 P.hybrida mRNA for MADS box containing protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016582207.16e-36PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
SwissprotA0A217EJJ06e-35AG11S_VITVI; Agamous-like MADS-box protein AGL11
SwissprotF6I4577e-35AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBLA0A1U8HFL21e-34A0A1U8HFL2_CAPAN; Floral homeotic protein AGAMOUS
TrEMBLA0A2G3AJX11e-34A0A2G3AJX1_CAPAN; agamous-like MADS-box protein AGL11 isoform X1
STRINGPGSC0003DMT4000132483e-35(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.23e-37MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Mejía N, et al.
    Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine.
    BMC Plant Biol., 2011. 11: p. 57
    [PMID:21447172]
  4. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]
  5. Malabarba J, et al.
    The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine.
    J. Exp. Bot., 2017. 68(7): p. 1493-1506
    [PMID:28369525]
  6. Royo C, et al.
    The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11.
    Plant Physiol., 2018. 177(3): p. 1234-1253
    [PMID:29853599]