PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01933g04004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 470aa    MW: 52432 Da    PI: 5.451
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01933g04004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS394.89.3e-121474281337
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               l++lLl+cA++v+sg+le+a+ +L ++s+l+spdgd+mqR+a+yf eALa r++rs+++lykal++++ s   +se + ++k+f+
  Peinf101Scf01933g04004.1  47 LIHLLLACANHVASGSLENANIALDHISHLSSPDGDTMQRIASYFSEALADRILRSWPGLYKALRSTKLS--VVSEDILVRKMFF 129
                               689*************************************************************999998..69*********** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e +P+lk++++++NqaI ea+ege++vHi+D+++ ++lQW aLlq L++Rpegpp+lRiTgv++    +ke l ++++ L++ Ae
  Peinf101Scf01933g04004.1 130 EFFPFLKVAFVVTNQAIIEAMEGEKMVHIVDLNAAEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLDQMAHVLTEEAE 210
                               ****************************************************************....9**************** PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll......................................... 214
                               +l++pf+fn+ v+++le+l++e+Lrvk+gEala+++vlqlh+ll                                         
  Peinf101Scf01933g04004.1 211 KLDIPFQFNA-VVSKLENLDVEKLRVKTGEALAISSVLQLHTLLahddekksplpfkhsngfhlqralinkntlgellekdvang 294
                               **********.799*********************************************************************** PP

                      GRAS 215 .........desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                                        +++++++s  + d++L ++++lsPkv+vv+eq+++hn+++++er++e+l+yy+alfd+le++lpr+s er k+E++
  Peinf101Scf01933g04004.1 295 yspsndtasSSPLCSTSstKMDSLLIALWGLSPKVMVVTEQDSNHNGTTLMERLSESLHYYAALFDCLESTLPRTSLERLKMENM 379
                               *******9844443333445789************************************************************** PP

                      GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
                               l+g+ei+n++aceg er+erhe+lekW +r+++aG  p+   ++ ++++
  Peinf101Scf01933g04004.1 380 LFGEEIKNIIACEGIERKERHEKLEKWFQRFDTAGDDPIFTMKTPTTSM 428
                               ***********************************77776665555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.81221445IPR005202Transcription factor GRAS
PfamPF035143.2E-11847428IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MIQDDGSSSV TSSSPLQIFP IMSLSPGFCS SNQWLKELKS EERGLYLIHL LLACANHVAS  60
GSLENANIAL DHISHLSSPD GDTMQRIASY FSEALADRIL RSWPGLYKAL RSTKLSVVSE  120
DILVRKMFFE FFPFLKVAFV VTNQAIIEAM EGEKMVHIVD LNAAEPLQWR ALLQDLSARP  180
EGPPHLRITG VHQQKEVLDQ MAHVLTEEAE KLDIPFQFNA VVSKLENLDV EKLRVKTGEA  240
LAISSVLQLH TLLAHDDEKK SPLPFKHSNG FHLQRALINK NTLGELLEKD VANGYSPSND  300
TASSSPLCST SSTKMDSLLI ALWGLSPKVM VVTEQDSNHN GTTLMERLSE SLHYYAALFD  360
CLESTLPRTS LERLKMENML FGEEIKNIIA CEGIERKERH EKLEKWFQRF DTAGDDPIFT  420
MKTPTTSMLA LVGEDAHFIC AEEQTIVVAD SVGGWSKKGI DSGKYSRQLM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-40352437217Protein SCARECROW
5b3h_A1e-40352436216Protein SCARECROW
5b3h_D1e-40352436216Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015061792.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A3Q7JDZ10.0A0A3Q7JDZ1_SOLLC; Uncharacterized protein
STRINGSolyc12g099900.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]