PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01860g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family MYB
Protein Properties Length: 488aa    MW: 52471.9 Da    PI: 4.9743
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01860g00002.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-173784148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g+WT  Ed +lv++v ++G g+W+++ ++ g+ R++k+c++rw ++l
  Peinf101Scf01860g00002.1 37 KGPWTSAEDAILVEYVMKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 84
                              79******************************************9986 PP

2Myb_DNA-binding21.45.8e-0790118130
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIart 30 
                               +g++T eE+ +++++++++G++ W++ a++
  Peinf101Scf01860g00002.1  90 KGAFTLEEERRIIELHAKMGNK-WARMAAE 118
                               799*******************.**99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.4253288IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-233587IPR009057Homeodomain-like
SMARTSM007177.2E-143686IPR001005SANT/Myb domain
PfamPF002491.7E-153784IPR001005SANT/Myb domain
SuperFamilySSF466892.94E-2438114IPR009057Homeodomain-like
CDDcd001672.28E-113984No hitNo description
PROSITE profilePS500906.12185124IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.6E-1288118IPR009057Homeodomain-like
SMARTSM007172089125IPR001005SANT/Myb domain
PfamPF002491.5E-590117IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MSITSETDDW MTSKVDMDSP DEANGGGNVG GSLPLKKGPW TSAEDAILVE YVMKHGEGNW  60
NAVQKHSGLA RCGKSCRLRW ANHLRPDLKK GAFTLEEERR IIELHAKMGN KWARMAAENK  120
QNEELGGLSS TDAQHPGLVA TNNFDIPPVE FKNLELNQLL CPPAHVEIPA SGFLAQVHSA  180
PYSSTSLLST VHPSKRIRGS ESMFSGSNGD LFLASCQYQN GGSLLAQPLG FSSYNHNLTY  240
DGQQSFSNVI PGSHAPLNGN SSTSEPTWAL KVELPSLQNQ TANWDSLSSP LHSLESVDTL  300
IQSPLAGHSE SVSLSPRNSG LLDAVLYGSQ TMNSSKDNSK QAEEETSADA VGNSCPDLLE  360
KGWETYGDPI SPLSRLPASV FTECTPTTGN SLHELQSTST MPGCNVKQEN ADQAPSDGKD  420
DMLNQTIFAS NCSSPKTQHT KNNLALKNAF GSGFFDDYGW DCKQVHSVAT SSGQACGRDS  480
AWDAMSAM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-203511625105MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015158630.10.0PREDICTED: transcription factor GAMYB-like isoform X2
TrEMBLA0A4D6FBN60.0A0A4D6FBN6_PETHY; MYB33b
STRINGPGSC0003DMT4000584260.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-53myb domain protein 33