PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01182g01006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 573aa    MW: 62981.1 Da    PI: 4.8957
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01182g01006.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.68.1e-1371885631374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               lv++L++cAeav++++++la+al+ ++  la ++  +m+++a+yf+eALa+r+++        + p+++ e++ +++l++   f+
  Peinf101Scf01182g01006.1 188 LVHTLMACAEAVQQENFNLADALVRHIGILAVSQSGAMRKVATYFAEALARRIYK--------IYPQDQIESSYTDVLQM--HFY 262
                               689***************************************************9........44555554455555444..4** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e++P+lkf+h+taNqaIlea++++++vH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++Ae
  Peinf101Scf01182g01006.1 263 ETCPYLKFAHFTANQAILEAFNNCNKVHVIDFSLKQGMQWPALMQALALRPAGPPAFRLTGIGPPQPDNSDALQQVGWKLAQLAE 347
                               ************************************************************************************* PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                               ++gv+fef+ +va++l+dl+   L++++ Ea+aVn+v++lhrll+++  le+    v++ vk ++Pk+v++veqea+hn+e F++
  Peinf101Scf01182g01006.1 348 TIGVEFEFRGFVANSLADLDATILDIRETEAVAVNSVFELHRLLARPRGLEK----VMSSVKLMKPKIVTIVEQEANHNAEMFMD 428
                               ********************************************99999999....***************************** PP

                      GRAS 256 rflealeyysalfdsleak.................lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323
                               rf eal+yys++fdsle++                 +   ++++ ++++++lgr+i+nvvaceg +r+erhetl++Wr r+++aG
  Peinf101Scf01182g01006.1 429 RFNEALHYYSTMFDSLESSsslsptttssstgqqpiV--VNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAG 511
                               ****************988899999998887665431..35999***************************************** PP

                      GRAS 324 Fkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               F pv+l+++a kqa++ll+ ++ ++gyrvee++g+l+lgW++rpL+++SaW+
  Peinf101Scf01182g01006.1 512 FAPVHLGSNAFKQASMLLALFAgGHGYRVEENDGCLMLGWHTRPLIATSAWQ 563
                               ***************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011292.5E-3531104No hitNo description
PfamPF120412.9E-353198IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.147162542IPR005202Transcription factor GRAS
PfamPF035142.8E-134188563IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MKRDRDREKS QVLGKSKIWE EEEQQPDAGM DELLAVLGYK VKSSDMAEVA QKLEQLEMAM  60
GTTLEDGINH LSTDTVHKNP SDLSGWVQSM LSELNNTSSI STNFDMAGST TGGVENELNI  120
SSSMNIINDD DLRAIPGGAV FVNNELEDAQ TSHKRLRSSS SSAGSSASFL TDSRPVVLVD  180
SQETGVRLVH TLMACAEAVQ QENFNLADAL VRHIGILAVS QSGAMRKVAT YFAEALARRI  240
YKIYPQDQIE SSYTDVLQMH FYETCPYLKF AHFTANQAIL EAFNNCNKVH VIDFSLKQGM  300
QWPALMQALA LRPAGPPAFR LTGIGPPQPD NSDALQQVGW KLAQLAETIG VEFEFRGFVA  360
NSLADLDATI LDIRETEAVA VNSVFELHRL LARPRGLEKV MSSVKLMKPK IVTIVEQEAN  420
HNAEMFMDRF NEALHYYSTM FDSLESSSSL SPTTTSSSTG QQPIVVNNQD LVMSEVYLGR  480
QICNVVACEG VDRVERHETL SQWRVRMNSA GFAPVHLGSN AFKQASMLLA LFAGGHGYRV  540
EENDGCLMLG WHTRPLIATS AWQLTAAAGG GES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-6318356213377Protein SCARECROW
5b3h_D1e-6318356213377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019232709.10.0PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI-like
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLM9N8J90.0M9N8J9_NICAT; ELLA domain GRAS family transcription factor
STRINGXP_009796771.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]