PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00645g09008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 670aa    MW: 72081.1 Da    PI: 5.0304
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00645g09008.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.42.1e-9234966941374
                      GRAS  41 laayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQW 125
                               +a+y +eAL+  l+ ++++l  ++++s+ s    + ++ a+k fse+sP+ +f+++t+Nqa+le ++g er+Hi+Dfdi++G+QW
  Peinf101Scf00645g09008.1 349 AAFYCKEALQLLLHANTNNLNPSMASSPFS---LIFKIGAYKSFSEISPVAQFANFTCNQALLEVLDGFERIHIVDFDIGYGGQW 430
                               799************999999888888888...**************************************************** PP

                      GRAS 126 paLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL..rvkpgEalaVnlvl 208
                               ++L+q+La R++g+p+l+iT+++sp+++++ el  t+e+L +fA+e+++ fef++l  ++l++   ++L   v+++Ea+aVnl  
  Peinf101Scf00645g09008.1 431 ASLMQELALRSGGAPTLKITALASPSTHDQLELGLTRENLIQFASEINMAFEFEILSIDSLNST-SWSLppLVSENEAIAVNLPA 514
                               *******************************************************977766665.4555334788********** PP

                      GRAS 209 qlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                               +  + +  ++sl+     vL++vk+lsP++vv v++ +d+++ +F +++++al+ ys l++sl+a    + ++ +k+Er+ll++ 
  Peinf101Scf00645g09008.1 515 SSLSSY--QLSLPL----VLRFVKQLSPRIVVSVDRGCDRTDLPFPNHVIQALQSYSNLLESLDAV-NVNFDALQKIERFLLQPG 592
                               777776..555555....*********************************************665.3466999*********** PP

                      GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               i+ +v+ + ++     e+ ++Wr+ + ++G++p+pls+++++qa++++++++++g++ve+++ slvl+W++++Lvs+SaWr
  Peinf101Scf00645g09008.1 593 IERIVMGRFRS----PEKTQHWRSLFLSSGLSPLPLSNFTESQAECVVKRTPVRGFHVEKRQSSLVLCWQRKELVSASAWR 669
                               *****998877....9****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.174279649IPR005202Transcription factor GRAS
PfamPF035147.4E-90349669IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    Send to blast
MKGMPLPFEF EGKGVLDLDI LFNKNSILNS WNNKNSHNSS TSKESCYFVN SPSAVLDTIR  60
SPIRPITSSS TLSSSLGGGG GGGGGTASTD TAGGVAAVSK NPSSKWQQQQ QDNTTATSSN  120
VGAESELPPP SLEMGGGGGT ATAAAAAGTE EWEGGISEMA SPCQEQSILR WIMGDVDDPS  180
MANLNKVLQV SGPVDYEFNG GFGVVDQGFG VDPANQIGSF MPSVSVSSSS FPPPSARMNS  240
DKIGLGSNTA TNLSQNPIFP SLSNNLGPGG FGQAQQQPFE NSDLKPQGFN SQFLINQHQT  300
QIPQNPSFLL PLPFAQQEQN LVLPPQAKRH NPGTIGGLEQ GSQISKGMAA FYCKEALQLL  360
LHANTNNLNP SMASSPFSLI FKIGAYKSFS EISPVAQFAN FTCNQALLEV LDGFERIHIV  420
DFDIGYGGQW ASLMQELALR SGGAPTLKIT ALASPSTHDQ LELGLTRENL IQFASEINMA  480
FEFEILSIDS LNSTSWSLPP LVSENEAIAV NLPASSLSSY QLSLPLVLRF VKQLSPRIVV  540
SVDRGCDRTD LPFPNHVIQA LQSYSNLLES LDAVNVNFDA LQKIERFLLQ PGIERIVMGR  600
FRSPEKTQHW RSLFLSSGLS PLPLSNFTES QAECVVKRTP VRGFHVEKRQ SSLVLCWQRK  660
ELVSASAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3235066944375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028065769.10.0scarecrow-like protein 6
SwissprotO813161e-140SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A4D8ZRK60.0A0A4D8ZRK6_SALSN; Uncharacterized protein
STRINGPGSC0003DMT4000667990.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-129GRAS family protein
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]