PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00576g03024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 529aa    MW: 58839 Da    PI: 5.1996
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00576g03024.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS374.21.6e-1141615223374
                      GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                               ++L++cA+av++++l+ a+ l+  l+ la+++  + +++a+yf++AL++r++++  +  +++  s       ++ l    +f+++
  Peinf101Scf00576g03024.1 161 TTLMACADAVQQNNLNVADILVRDLKMLAAQQFGAKKKVATYFAQALNQRIHGT--NQQHIVDYSY-----YTDDL-LWMIFYKT 237
                               68***************************************************2..1122222222.....23333.3458**** PP

                      GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeel 172
                               +P++kf++l+ NqaIl+a+++++rvH+iDf++++GlQWpaL++aLa Rp+gpp + +T++g+ +s++ ++ +++g +LakfAe++
  Peinf101Scf00576g03024.1 238 CPYIKFAYLASNQAILDAFANSNRVHVIDFSLKEGLQWPALMEALARRPGGPPAFWLTAIGPLRSNNINNFQQIGGKLAKFAETV 322
                               ************************************************************************************* PP

                      GRAS 173 gvpfefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                               gv+fef+ +++++l+d++   L+++p   +++aVn+v++lh+ l+ s+++e+    +L+ +k+++Pk+v+++eqea+hn++ +++
  Peinf101Scf00576g03024.1 323 GVEFEFREILVNSLADVDATVLNIRPssVDVVAVNSVFELHHALSTSGTIEK----LLNSIKEMQPKIVTITEQEANHNGHALVD 403
                               **************************999***************99999999....***************************** PP

                      GRAS 256 rflealeyysalfdsl.eak.lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                               rf ea +yys++f+s+ +++ + ++s    +vE+  lgr+i nvvaceg+er+erhetl++W+ r+++aGF  v+l++++++qa+
  Peinf101Scf00576g03024.1 404 RFKEAWDYYSTMFESMeNSEvMQPNSPYSEMVEKY-LGRQINNVVACEGTERVERHETLSQWQVRMNSAGFVRVHLRSNTYNQAR 487
                               ****************6444356666888888887.************************************************* PP

                      GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +ll +++  gy+ve ++g++ l W++rpL+++SaW+
  Peinf101Scf00576g03024.1 488 SLLLQHSRAGYKVEANDGCM-LSWNSRPLIAISAWQ 522
                               **************999986.8*************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.837133503IPR005202Transcription factor GRAS
PfamPF035145.7E-112161522IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MNRSSSEMSS IESMMEDEDS YLSNTDAIIY GTSDHSGWGG DSMISDPNIA LSTTSTDDHY  60
QLQISIAAGD GGDASTIVSS VSSSSWFMNN NKQSDYQQET RVFFVDYRAT SGFAICQNSH  120
KEELEGPESS NRLKSCAGLE LGLTLNIAGA LNNGTRGRLF TTLMACADAV QQNNLNVADI  180
LVRDLKMLAA QQFGAKKKVA TYFAQALNQR IHGTNQQHIV DYSYYTDDLL WMIFYKTCPY  240
IKFAYLASNQ AILDAFANSN RVHVIDFSLK EGLQWPALME ALARRPGGPP AFWLTAIGPL  300
RSNNINNFQQ IGGKLAKFAE TVGVEFEFRE ILVNSLADVD ATVLNIRPSS VDVVAVNSVF  360
ELHHALSTSG TIEKLLNSIK EMQPKIVTIT EQEANHNGHA LVDRFKEAWD YYSTMFESME  420
NSEVMQPNSP YSEMVEKYLG RQINNVVACE GTERVERHET LSQWQVRMNS AGFVRVHLRS  480
NTYNQARSLL LQHSRAGYKV EANDGCMLSW NSRPLIAISA WQLAPPSLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-491595224375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490697.11e-173PREDICTED: DELLA protein GAI-like
SwissprotQ7Y1B61e-154GAI_SOLLC; DELLA protein GAI
TrEMBLA0A1S4BP731e-172A0A1S4BP73_TOBAC; DELLA protein GAI-like
STRINGSolyc10g086380.1.11e-170(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-137GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]