PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00497g06019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 556aa    MW: 60950.5 Da    PI: 4.8047
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00497g06019.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS391.59.3e-1201975531374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               lv++L++cAea+++++++la+alL+++  la +++ +m+++a+yf+eALa++++r        l p++ ++  s+ +   +  f+
  Peinf101Scf00497g06019.1 197 LVHTLMACAEAIQQDNFKLAEALLKQIGFLAVSQAGAMRKVATYFAEALARKIYR--------LYPTNPND--SAFTDLLQMHFY 271
                               689****************************************************........44555543..4444444446** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e++P+lkf+h+taNqaIlea+ g+++vH+iDf+++qG+QWpaLlqaLa Rp+g+p++R+Tg+g+p++++++ l+e+g++La++A+
  Peinf101Scf00497g06019.1 272 ETCPYLKFAHFTANQAILEAFTGKSKVHVIDFSMKQGMQWPALLQALALRPGGAPTFRLTGIGPPAHDNTDHLQEVGWKLAQLAD 356
                               ************************************************************************************* PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                               +++v+fef+ +va++++dl+  ++++++gE++aVn++++lh ll++++ +e+    vL++vk+++P++++vveqea+hn++ F +
  Peinf101Scf00497g06019.1 357 SINVEFEFRGFVANSIADLNATMFDIREGETVAVNSIFELHPLLARPGGVEK----VLSFVKDMKPEIFTVVEQEANHNGPGFID 437
                               ***************************************************9....***************************** PP

                      GRAS 256 rflealeyysalfdsleak.............lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                               rf+e+l+yys+lfdsle               l++ s++++++++++lgr+i nv                 Wr r+++ GF+pv
  Peinf101Scf00497g06019.1 438 RFTESLHYYSTLFDSLEGCgaggggaggvggeLGPVSDQDKMMSEVYLGRQILNV-----------------WRTRFNSGGFEPV 505
                               ****************988899**********9999****************997.................************* PP

                      GRAS 328 plsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +l+++a kqa++ll+ ++ + gyrvee++g+l+lgW++rpL+++SaW+
  Peinf101Scf00497g06019.1 506 HLGSNAFKQASMLLALFAgGGGYRVEENNGCLMLGWHTRPLIATSAWK 553
                               ******************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120416.6E-3442108IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.2E-3342115No hitNo description
PROSITE profilePS5098557.927171532IPR005202Transcription factor GRAS
PfamPF035143.2E-117197553IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MKRNQNQTTS YQQQEQENNN SSSSNTGKAK MWEQEQQDAG VDELLAVLGY KVKASDMAEV  60
ASKLEQLEQV MGSVQQDNLS FLASETVHYN PSDLSSWLES MISEFNPHDP FTPNTNDKTN  120
IVYDDSSFDS DLTAIPGKAL LSQVEPESKR FKMEISSSSS SLSVDSTMWG SAGTPLPEST  180
ATRPVVLVDS QDNGVRLVHT LMACAEAIQQ DNFKLAEALL KQIGFLAVSQ AGAMRKVATY  240
FAEALARKIY RLYPTNPNDS AFTDLLQMHF YETCPYLKFA HFTANQAILE AFTGKSKVHV  300
IDFSMKQGMQ WPALLQALAL RPGGAPTFRL TGIGPPAHDN TDHLQEVGWK LAQLADSINV  360
EFEFRGFVAN SIADLNATMF DIREGETVAV NSIFELHPLL ARPGGVEKVL SFVKDMKPEI  420
FTVVEQEANH NGPGFIDRFT ESLHYYSTLF DSLEGCGAGG GGAGGVGGEL GPVSDQDKMM  480
SEVYLGRQIL NVWRTRFNSG GFEPVHLGSN AFKQASMLLA LFAGGGGYRV EENNGCLMLG  540
WHTRPLIATS AWKLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6120455226378Protein SCARECROW
5b3h_A2e-6120455225377Protein SCARECROW
5b3h_D2e-6120455225377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009789076.10.0PREDICTED: DELLA protein GAI1-like
RefseqXP_016452673.10.0PREDICTED: DELLA protein GAI1-like
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A1S3YKV30.0A0A1S3YKV3_TOBAC; DELLA protein GAI1-like
TrEMBLA0A1U7XHE40.0A0A1U7XHE4_NICSY; DELLA protein GAI1-like
STRINGXP_009789076.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein