PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00342g12001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 198aa MW: 21988.5 Da PI: 7.4083 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175.2 | 6.6e-55 | 25 | 120 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 +e d+flPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk y Peinf101Scf00342g12001.1 25 KELDKFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKGY 109 788********************************************************************************** PP NF-YB 87 lkkyrelegek 97 l+kyre+egek Peinf101Scf00342g12001.1 110 LNKYRETEGEK 120 *********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.3E-52 | 21 | 137 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.42E-40 | 28 | 148 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.2E-27 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.2E-19 | 58 | 76 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.2E-19 | 77 | 95 | No hit | No description |
PRINTS | PR00615 | 3.2E-19 | 96 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MTGKRSQNSP VGSPLSGNVS DNSSKELDKF LPIANVSRIM KKSLPANAKI SKEAKETVQE 60 CVSEFISFIT GEASDKCQRE KRKTINGDDL LWAMTTLGFE NYVGPLKGYL NKYRETEGEK 120 NIMARNEEPS EVPTTSNSAN TYDHVTKFSL ARPELIRSFN NGNFSEMNNL KSYGDNYGRV 180 IGYGENVTSA ANLHGVEW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-45 | 25 | 115 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-45 | 25 | 115 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:20566706, PubMed:21148627). Regulates plant height by promoting cell elongation in the internodes (PubMed:20566706). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:20566706, ECO:0000269|PubMed:21148627}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269|PubMed:26542958}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975516 | 1e-117 | HG975516.1 Solanum lycopersicum chromosome ch04, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009787043.1 | 1e-114 | PREDICTED: nuclear transcription factor Y subunit B-3-like isoform X1 | ||||
Refseq | XP_009787044.1 | 1e-114 | PREDICTED: nuclear transcription factor Y subunit B-3-like isoform X2 | ||||
Refseq | XP_016490537.1 | 1e-114 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 4e-60 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q0J7P4 | 2e-59 | HD5_ORYSJ; Nuclear transcription factor Y subunit B-11 | ||||
TrEMBL | A0A1S4BNT7 | 1e-113 | A0A1S4BNT7_TOBAC; nuclear transcription factor Y subunit B-3-like | ||||
TrEMBL | A0A1U7X867 | 1e-113 | A0A1U7X867_NICSY; nuclear transcription factor Y subunit B-3-like isoform X1 | ||||
TrEMBL | A0A1U7XJC7 | 1e-113 | A0A1U7XJC7_NICSY; nuclear transcription factor Y subunit B-3-like isoform X2 | ||||
STRING | XP_009787043.1 | 1e-113 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-62 | nuclear factor Y, subunit B3 |