PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00200g01010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 198aa MW: 22615.9 Da PI: 10.4186 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 175.3 | 1.8e-54 | 15 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWka Peinf101Scf00200g01010.1 15 LPPGFRFHPTDEELVVHYLKKKAASAPLPV-NIIAEVDLYKFDPWELPSKANFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKA 98 79****************************.89***************99999******************************** PP NAM 86 tgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 tg+dk++++ +++vg+kk Lvfy+g+ pkg kt+Wvmheyrl Peinf101Scf00200g01010.1 99 TGTDKPIFTCnVTRKVGVKKALVFYRGKPPKGIKTNWVMHEYRL 142 *******99646778***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.36E-61 | 8 | 147 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.596 | 15 | 162 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.7E-29 | 16 | 142 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MENTGLMSSS NHLHLPPGFR FHPTDEELVV HYLKKKAASA PLPVNIIAEV DLYKFDPWEL 60 PSKANFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPIFTCNV TRKVGVKKAL 120 VFYRGKPPKG IKTNWVMHEY RLVDNNSSLT KKGSLRCSSG NGQGRFNGGY DMFTYNAIFI 180 NKCFRAKSKH ISVERIKF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-66 | 11 | 144 | 13 | 144 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-66 | 11 | 144 | 13 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-66 | 11 | 144 | 13 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-66 | 11 | 144 | 13 | 144 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-66 | 11 | 144 | 16 | 147 | NAC domain-containing protein 19 |
3swm_B | 3e-66 | 11 | 144 | 16 | 147 | NAC domain-containing protein 19 |
3swm_C | 3e-66 | 11 | 144 | 16 | 147 | NAC domain-containing protein 19 |
3swm_D | 3e-66 | 11 | 144 | 16 | 147 | NAC domain-containing protein 19 |
3swp_A | 3e-66 | 11 | 144 | 16 | 147 | NAC domain-containing protein 19 |
3swp_B | 3e-66 | 11 | 144 | 16 | 147 | NAC domain-containing protein 19 |
3swp_C | 3e-66 | 11 | 144 | 16 | 147 | NAC domain-containing protein 19 |
3swp_D | 3e-66 | 11 | 144 | 16 | 147 | NAC domain-containing protein 19 |
4dul_A | 2e-66 | 11 | 144 | 13 | 144 | NAC domain-containing protein 19 |
4dul_B | 2e-66 | 11 | 144 | 13 | 144 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. {ECO:0000250}. | |||||
UniProt | Transcription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF509875 | 0.0 | AF509875.1 Petunia x hybrida nam-like protein 12 (NH12) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009780447.1 | 1e-102 | PREDICTED: NAC transcription factor 25-like | ||||
Refseq | XP_016488493.1 | 1e-102 | PREDICTED: NAC transcription factor 25-like | ||||
Swissprot | A2YMR0 | 3e-86 | NAC10_ORYSI; NAC transcription factor ONAC010 | ||||
Swissprot | Q8GY42 | 7e-87 | NAC25_ARATH; NAC transcription factor 25 | ||||
TrEMBL | A0A1S4BHZ5 | 1e-101 | A0A1S4BHZ5_TOBAC; NAC transcription factor 25-like | ||||
TrEMBL | A0A1U7WKF9 | 1e-101 | A0A1U7WKF9_NICSY; NAC transcription factor 25-like | ||||
STRING | XP_009780447.1 | 1e-102 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1814 | 24 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 3e-89 | NAC domain containing protein 25 |