PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peinf101Scf00185g04023.1

Organism

Petunia inflata

Taxonomic ID

212142

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia

Family

MYB_related

Protein Properties

Length: 96aa MW: 11127.8 Da PI: 9.8657

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peinf101Scf00185g04023.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	44.1	4.7e-14	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd +l + + G +W+ +++ g+ R++k+c++rw ++l Peinf101Scf00185g04023.1 14 RGPWTVEEDHKLTNFILNNGIQNWRHVPKLAGLVRCGKSCRLRWMNHL 61 89****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.0E-21	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.572	9	65	IPR017930	Myb domain
SMART	SM00717	2.2E-8	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	5.3E-12	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	6.58E-21	15	88	IPR009057	Homeodomain-like
CDD	cd00167	5.72E-7	16	61	No hit	No description
PROSITE profile	PS50090	4.414	62	96	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	5.5E-8	65	88	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 96 aa Download sequence Send to blast
MGKQPCCDNV GHNRGPWTVE EDHKLTNFIL NNGIQNWRHV PKLAGLVRCG KSCRLRWMNH 60 LRPDLKKGAF TEDEEYMLIK LQSQLGNRIN SSLKNQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	3e-15	13	88	26	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269\|PubMed:23660402}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269\|PubMed:23660402}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004239173.1	3e-46	transcription factor MYB20
Refseq	XP_019176697.1	3e-46	PREDICTED: myb-related protein 315
Swissprot	Q9C7U7	6e-39	MYB20_ARATH; Transcription factor MYB20
TrEMBL	A0A3Q7GHU1	7e-45	A0A3Q7GHU1_SOLLC; Uncharacterized protein
STRING	Solyc05g014290.2.1	1e-45	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14340.1	2e-45	myb domain protein 40

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]