PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00022g02006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 529aa    MW: 59369.2 Da    PI: 5.5679
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00022g02006.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS449.42.4e-1371595291374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               l+e+L++cA+a+++++l  a++l++ l++ +s  g+p+qRl ay++e+L arla+s+s++ykal+++e +   s+e l++++l++
  Peinf101Scf00022g02006.1 159 LKEVLVACAKAIADNNLVTAEWLMSDLRTAVSVCGSPIQRLGAYMLEGLVARLASSGSSIYKALRCKEPT---SVELLSYMHLLY 240
                               5789*****************************************************************9...9*********** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakf 168
                               e++P++kf++l aN aI++a++ e+++HiiDf+i qG QW++L++aLa+Rp+gpp++RiTg+++++s   +   le +g+rL+++
  Peinf101Scf00022g02006.1 241 EICPYFKFGYLSANGAIVDAMKDENTIHIIDFQIAQGSQWITLIHALAARPGGPPRIRITGIDDSTSAyaRGGGLEIVGRRLSSL 325
                               ****************************************************************998899999************ PP

                      GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                               A++++vpfef++ v+++++d+e+e+L+v+pgE laVn++l lh+++desv ++++rd++L++vkslsPk+v++veqe+++n  +F
  Peinf101Scf00022g02006.1 326 AASCNVPFEFHP-VVSSCSDIEIEHLNVRPGEPLAVNFALILHHMPDESVGTQNHRDRILRMVKSLSPKIVTLVEQESNTNMVQF 409
                               ************.7999******************************************************************** PP

                      GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                               + rfle+l+yy ++f+s+++ lpr+++eri+vE+++l+reivn++acegaer+erhe le+W++r+ +aGFkp+pls+++++++k
  Peinf101Scf00022g02006.1 410 FPRFLETLNYYLSIFESIDVALPRDHKERINVEQHCLAREIVNIIACEGAERVERHELLERWKSRFFTAGFKPYPLSSSVNATIK 494
                               ************************************************************************************* PP

                      GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +ll++++ + y+++e++g+l+lgW++r+Lv+ +aW+
  Peinf101Scf00022g02006.1 495 TLLQNYY-KSYTLDERNGALYLGWMNRNLVASCAWK 529
                               *******.55*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.049133510IPR005202Transcription factor GRAS
PfamPF035148.2E-135159529IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MRPSQNPNDI NKFNRFYNQQ VEDQESFFMP SVNNPHNNQF LYADYGQQTQ FSALKPDQCC  60
YVESSGELVP DIHQGSDSCP SDMHHSPDDT FHSSGNSSCF TSDVTDLKHK LRELETAMLG  120
PDLESLESYN NTPLAAASQV SSESDKWVEI KEMMPSGDLK EVLVACAKAI ADNNLVTAEW  180
LMSDLRTAVS VCGSPIQRLG AYMLEGLVAR LASSGSSIYK ALRCKEPTSV ELLSYMHLLY  240
EICPYFKFGY LSANGAIVDA MKDENTIHII DFQIAQGSQW ITLIHALAAR PGGPPRIRIT  300
GIDDSTSAYA RGGGLEIVGR RLSSLAASCN VPFEFHPVVS SCSDIEIEHL NVRPGEPLAV  360
NFALILHHMP DESVGTQNHR DRILRMVKSL SPKIVTLVEQ ESNTNMVQFF PRFLETLNYY  420
LSIFESIDVA LPRDHKERIN VEQHCLAREI VNIIACEGAE RVERHELLER WKSRFFTAGF  480
KPYPLSSSVN ATIKTLLQNY YKSYTLDERN GALYLGWMNR NLVASCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A7e-6816652825377Protein SCARECROW
5b3h_D7e-6816652825377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755190.0HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804325.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009804326.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_016487146.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A1S4BEA60.0A0A1S4BEA6_TOBAC; scarecrow-like transcription factor PAT1
TrEMBLA0A1U7YQT40.0A0A1U7YQT4_NICSY; scarecrow-like transcription factor PAT1
STRINGXP_009804325.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]