PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01005828G0060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 318aa    MW: 35395 Da    PI: 5.39
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01005828G0060genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.6e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l   +   G  +W+++++  g+ R++k+c++rw +yl
  PH01005828G0060 14 KGPWTAEEDQKLMIFILSNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.32.7e-1670111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++l vd+++qlG++ W++Ia+++  gRt++++k++w+++
  PH01005828G0060  70 LSEAEEKLVVDLHAQLGNR-WSKIASHLA-GRTDNEIKNHWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-20563IPR009057Homeodomain-like
PROSITE profilePS5129414.344961IPR017930Myb domain
SuperFamilySSF466891.16E-2511108IPR009057Homeodomain-like
SMARTSM007172.3E-91363IPR001005SANT/Myb domain
PfamPF002491.8E-121461IPR001005SANT/Myb domain
CDDcd001671.00E-61661No hitNo description
PROSITE profilePS5129426.25362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2364117IPR009057Homeodomain-like
SMARTSM007178.3E-1566114IPR001005SANT/Myb domain
PfamPF002498.7E-1470111IPR001005SANT/Myb domain
CDDcd001674.45E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLMIFIL SNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEAEEKLVVD LHAQLGNRWS KIASHLAGRT DNEIKNHWNT HIKKKLKKMG  120
IDPLTHKPLP QQQQHDQNPP LAGDWPEIQG PPPEQKHPEE EATAETVTDQ HDEELLLRKS  180
PGFCTDEVPM IHPDEIMIPL CDQPPPPPPP PPPPTTTCAA ASAPTTSHST STSTSASSSS  240
SASTSCDEDT LRSIMEWPDT MYLMGLDDMI AALPSTWDDC RVQPAPAPAY EDTFNAYQYQ  300
RNSGAFDQEA WNKLELF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01005828G0060
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0926060.0FP092606.1 Phyllostachys edulis cDNA clone: bphylf044c24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973482.11e-123myb-related protein 315
TrEMBLK3YIS51e-122K3YIS5_SETIT; Uncharacterized protein
STRINGSi014144m1e-123(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.19e-92myb domain protein 43