PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01005460G0120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 298aa    MW: 32145.3 Da    PI: 7.9755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01005460G0120genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.39.7e-201257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEd+ l ++v+q+G ++W++I r+++ gR++k+c++rw + 
  PH01005460G0120 12 RGPWSPEEDDALRRLVEQHGARNWTAIGREIP-GRSGKSCRLRWCNQ 57
                     89******************************.***********985 PP

2Myb_DNA-binding46.86.6e-1564106145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r ++T+eEd  +++a+ + G++ W++Iar +  gRt++ +k++w+
  PH01005460G0120  64 RRPFTEEEDATILRAHVRVGNR-WAAIARLLH-GRTDNAVKNHWN 106
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.975762IPR017930Myb domain
SuperFamilySSF466892.55E-309105IPR009057Homeodomain-like
SMARTSM007172.2E-171160IPR001005SANT/Myb domain
PfamPF002491.1E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-261365IPR009057Homeodomain-like
CDDcd001672.79E-161456No hitNo description
SMARTSM007171.5E-1363111IPR001005SANT/Myb domain
PROSITE profilePS5129417.92264113IPR017930Myb domain
PfamPF002498.0E-1364106IPR001005SANT/Myb domain
CDDcd001675.84E-1066106No hitNo description
Gene3DG3DSA:1.10.10.605.8E-2266113IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGGVEVECDR IRGPWSPEED DALRRLVEQH GARNWTAIGR EIPGRSGKSC RLRWCNQLSP  60
QVERRPFTEE EDATILRAHV RVGNRWAAIA RLLHGRTDNA VKNHWNCSLK RKLAVATVAA  120
GGVAADCADC ERPCKRVSPS PDSPSGSRSG SDRSDLSHGV GFGQIYRPVA RTGGFEPADC  180
AISRRHEADP LTSLSLSLPG MDQAFNHDSA HSHFQELPPS PSPPPPPVTA TPSYPFSPEF  240
MAAMQEMIRA EVQKYMASVG VRAGCGAAGG ADLFMPQLME GVMRAAAERV GGVGRMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-3791134108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01005460G0120
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0933540.0FP093354.1 Phyllostachys edulis cDNA clone: bphyem209d17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641187.11e-149transcription factor MYB77
TrEMBLA0A0E0LDT21e-149A0A0E0LDT2_ORYPU; Uncharacterized protein
STRINGOPUNC06G19910.11e-150(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.14e-61myb domain protein 77