PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01005192G0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 290aa    MW: 30825.4 Da    PI: 6.7581
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01005192G0010genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +v+++G+g+W+++++  g+ R+ k+c++rw +yl
  PH01005192G0010 14 KGPWTPEEDIILVSYVQEHGPGNWRAVPANTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding45.91.3e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E+ l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  PH01005192G0010  67 RGNFSGQEENLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.542965IPR017930Myb domain
SuperFamilySSF466897.76E-3011108IPR009057Homeodomain-like
SMARTSM007176.5E-141363IPR001005SANT/Myb domain
PfamPF002499.1E-171461IPR001005SANT/Myb domain
CDDcd001671.62E-121661No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129419.14666116IPR017930Myb domain
SMARTSM007179.8E-1566114IPR001005SANT/Myb domain
PfamPF002491.7E-1367112IPR001005SANT/Myb domain
CDDcd001672.88E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGRPPCCSKE GVKKGPWTPE EDIILVSYVQ EHGPGNWRAV PANTGLMRCS KSCRLRWTNY  60
LRPGIRRGNF SGQEENLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLQRTA  120
ALSSSTEQQG SPPPNKGQWE RRLQTDINLA RRALREAISV DVGASPSGGS ATSPAPSEST  180
AYALSAENIS RMLDGWAPGK TAGAGNPATP GAAESASGPS ELTEWSGSSA SNCAAPVLAS  240
SLFGYESKTS AAAAGEVPLS AIESWLLLDD SSEQPAQEGL LFEISQACS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-25141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01005192G0010
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0988920.0FP098892.1 Phyllostachys edulis cDNA clone: bphylf052j22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561588.11e-115myb-related protein 306
RefseqXP_025794825.11e-114transcription factor MYB30-like
SwissprotP813923e-99MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A2S3IQ771e-113A0A2S3IQ77_9POAL; Uncharacterized protein
TrEMBLI1H5111e-113I1H511_BRADI; Uncharacterized protein
STRINGBRADI1G61160.11e-114(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-92myb domain protein 96
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]