PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01004868G0120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HB-other
Protein Properties Length: 360aa    MW: 39884.9 Da    PI: 6.8357
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01004868G0120genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.34e-2154109156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  PH01004868G0120  54 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 109
                      688999***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-2239105IPR009057Homeodomain-like
SuperFamilySSF466893.72E-2042112IPR009057Homeodomain-like
PROSITE profilePS5007117.26551111IPR001356Homeobox domain
SMARTSM003892.1E-1952115IPR001356Homeobox domain
PfamPF000461.1E-1854109IPR001356Homeobox domain
CDDcd000863.31E-1954112No hitNo description
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PROSITE profilePS5084810.833205293IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MEMELSGGSG SGHLDGLLSF AGVDDERDQK PQHSGHEQAD GGQQQSAAAS NSKKKRYHRH  60
TAHQIQQMEA LFKECPHPDD KQRLKLSQEL GLKPRQVKFW FQNRRTQMKA QQDRADNVIL  120
RAENDSLKSE NYRLQAAIRN VVCPNCGHAA VLGEMTYEEQ QLRIDNARLK DEQSVMGCAD  180
LIPPVVPQQI ADHGVAYVGA MAPVQEQDKQ LVLDLASTAA DHLAKMCRAN EPLWVRRRGA  240
TSEIMAVDEH VQMFSWPVDG GKQGDVAVAR TEGTRDSAVV IMNSITLVDA FLDALVSVYA  300
SINYVKLMHT DAKKKKTGYA EQMDGAVPFD CLQGKNHSGD KQWSCFWSSG QRISPLGNY*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01004868G0120
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509861e-145AJ250986.2 Zea mays mRNA for OCL4 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798256.11e-150homeobox-leucine zipper protein ROC3
RefseqXP_025798257.11e-150homeobox-leucine zipper protein ROC3
SwissprotQ336P21e-145ROC3_ORYSJ; Homeobox-leucine zipper protein ROC3
TrEMBLA0A0E0MB471e-157A0A0E0MB47_ORYPU; Uncharacterized protein
STRINGOPUNC10G17890.11e-157(Oryza punctata)
STRINGOPUNC10G17920.11e-157(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78463441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.17e-66homeobox-7
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Chou IT,Gasser CS
    Characterization of the cyclophilin gene family of Arabidopsis thaliana and phylogenetic analysis of known cyclophilin proteins.
    Plant Mol. Biol., 1997. 35(6): p. 873-92
    [PMID:9426607]