PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01004865G0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 241aa    MW: 27174.2 Da    PI: 12.1748
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01004865G0070genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv +++ +G g+W++ ++  g+ R++k+c++rw +yl
  PH01004865G0070 14 KGAWTKEEDQRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding55.81.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T +Edel+++++ +lG++ W++Ia  ++ gRt++++k++w+++
  PH01004865G0070  67 RGNFTDDEDELIIRLHSLLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.056961IPR017930Myb domain
SuperFamilySSF466892.25E-2913108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001673.11E-101661No hitNo description
PROSITE profilePS5129428.162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.4E-2865116IPR009057Homeodomain-like
SMARTSM007171.4E-1666114IPR001005SANT/Myb domain
PfamPF002498.7E-1667111IPR001005SANT/Myb domain
CDDcd001672.06E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIR AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDDEDELIIR LHSLLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLARG  120
IDPQTHRPLL SGSPQRLARR RRSPSPSRRR RPRCSPSRSR RRRSSPRTMA AAAAAARRAR  180
GSRGAPTSTS TCLWGLRRAR RRSACATTSA SAAGRRAAVR LTARAYRGLD IRPLEEGQYI  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148162RRRPRCSPSRSRRRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01004865G0070
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica. {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0668340.0AK066834.1 Oryza sativa Japonica Group cDNA clone:J013083O13, full insert sequence.
GenBankAK1040530.0AK104053.1 Oryza sativa Japonica Group cDNA clone:001-023-G03, full insert sequence.
GenBankD886170.0D88617.1 Oryza sativa mRNA for OSMYB1, complete cds.
GenBankEU8372460.0EU837246.1 Oryza sativa Japonica Group clone KCS051A09 myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638107.16e-94transcription factor MYB8
SwissprotP813932e-87MYB08_ANTMA; Myb-related protein 308
SwissprotQ388512e-87MYB6_ARATH; Transcription repressor MYB6
TrEMBLA0A0E0PMV11e-92A0A0E0PMV1_ORYRU; Uncharacterized protein
TrEMBLA2Y4Y51e-92A2Y4Y5_ORYSI; Uncharacterized protein
TrEMBLB9FIY31e-92B9FIY3_ORYSJ; Uncharacterized protein
TrEMBLO238891e-92O23889_ORYSA; OSMYB1
TrEMBLQ5TKI81e-92Q5TKI8_ORYSJ; Myb transcription factor
STRINGORUFI05G18670.12e-93(Oryza rufipogon)
STRINGOS05T0429900-012e-93(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.14e-87myb domain protein 4
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]