PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01004818G0120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 273aa    MW: 30731.3 Da    PI: 6.8715
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01004818G0120genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-182370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed+ lv++++++G g+W++ ar  g++Rt+k+c++rw++yl
  PH01004818G0120 23 RGPWTVDEDLTLVNYIAEHGEGRWNALARAAGLKRTGKSCRLRWLNYL 70
                     89********************************************97 PP

2Myb_DNA-binding54.72.3e-1776119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  PH01004818G0120  76 RGNFSAEEQLLILDLHSRWGNR-WSKIAQRLP-GRTDNEIKNYWRT 119
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9011870IPR017930Myb domain
SuperFamilySSF466891.61E-3020117IPR009057Homeodomain-like
SMARTSM007174.0E-152272IPR001005SANT/Myb domain
PfamPF002491.3E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-232477IPR009057Homeodomain-like
CDDcd001672.23E-102570No hitNo description
PROSITE profilePS5129423.55871125IPR017930Myb domain
SMARTSM007172.0E-1575123IPR001005SANT/Myb domain
PfamPF002496.0E-1676119IPR001005SANT/Myb domain
CDDcd001671.35E-1078119No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2478124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MACRPGPTTP PAQEQESEAD LRRGPWTVDE DLTLVNYIAE HGEGRWNALA RAAGLKRTGK  60
SCRLRWLNYL RPDVKRGNFS AEEQLLILDL HSRWGNRWSK IAQRLPGRTD NEIKNYWRTR  120
VQKHAKQLNC DVNSKRFKDA MKYLWMPRLA ERVQASAGAG AGDGYGTGDA PCVSGLTMAT  180
TTCLGNSPSM VTSSSSDSFT SESHEEKSLH VHGGGEKMSR GDWMQEADHE FWSMPIQPND  240
QFQDQQLNGW VQGFSEGVSE NLWSLEDIWK MQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-252012324126MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269|PubMed:11310740}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01004818G0120
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:11310740}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7284141e-129KJ728414.1 Zea mays clone pUT6719 MYB transcription factor (MYB4) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663109.11e-141PREDICTED: transcription factor MYB108-like
RefseqXP_015618000.11e-141transcription factor JAMYB
SwissprotQ2QZJ81e-142JAMYB_ORYSJ; Transcription factor JAMYB
TrEMBLA0A0E0RC241e-140A0A0E0RC24_ORYRU; Uncharacterized protein
TrEMBLJ3NA961e-140J3NA96_ORYBR; Uncharacterized protein
STRINGORUFI11G24630.11e-141(Oryza rufipogon)
STRINGOS11T0684000-011e-141(Oryza sativa)
STRINGOB11G27320.11e-140(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.13e-78myb domain protein 78
Publications ? help Back to Top
  1. Ahn IP,Kim S,Kang S,Suh SC,Lee YH
    Rice Defense Mechanisms Against Cochliobolus miyabeanus and Magnaporthe grisea Are Distinct.
    Phytopathology, 2005. 95(11): p. 1248-55
    [PMID:18943354]
  2. Campos-Soriano L,García-Martínez J,San Segundo B
    The arbuscular mycorrhizal symbiosis promotes the systemic induction of regulatory defence-related genes in rice leaves and confers resistance to pathogen infection.
    Mol. Plant Pathol., 2012. 13(6): p. 579-92
    [PMID:22212404]
  3. Yokotani N, et al.
    Role of the rice transcription factor JAmyb in abiotic stress response.
    J. Plant Res., 2013. 126(1): p. 131-9
    [PMID:22847900]
  4. Wang D, et al.
    Expression analysis of innate immunity related genes in the true/field blast resistance gene-mediated defence response.
    Biotechnol. Biotechnol. Equip., 2014. 28(6): p. 999-1007
    [PMID:26740780]
  5. Fred AK,Kiswara G,Yi G,Kim KM
    Screening Rice Cultivars for Resistance to Bacterial Leaf Blight.
    J. Microbiol. Biotechnol., 2016. 26(5): p. 938-45
    [PMID:26869604]