PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003809G0130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 342aa    MW: 37143.9 Da    PI: 4.9378
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003809G0130genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l+++++q+G   W++ ++  g+ R++k+c++rw +yl
  PH01003809G0130 14 RGRWTAEEDEILANYIAQHGEAAWRSLPKNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding537.8e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eEd+ ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  PH01003809G0130  67 RGNISKEEDDVIIKLHATLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.597961IPR017930Myb domain
SuperFamilySSF466895.24E-2811108IPR009057Homeodomain-like
SMARTSM007178.2E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
CDDcd001671.64E-91661No hitNo description
PROSITE profilePS5129425.43662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2565116IPR009057Homeodomain-like
SMARTSM007175.2E-1766114IPR001005SANT/Myb domain
PfamPF002493.8E-1567112IPR001005SANT/Myb domain
CDDcd001673.82E-1271112No hitNo description
PfamPF066407.8E-58130336IPR010588Myb-related protein P, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDEILANYIA QHGEAAWRSL PKNAGLLRCG KSCRLRWINY  60
LRAGVKRGNI SKEEDDVIIK LHATLGNRWS LIASHLPGRT DNEIKNYWNS HLSRQIHTFR  120
RTYTAGPDTA VTIDINKLSA AGKRRGGRTA GQSPKSSNKK RPERESTTKA NENGASSPAA  180
AASAASSPPQ SDEARSAVVD PEQSQPNNNS TSISHTPDEP CSENATGPMV FDPVDQMRLW  240
EADSAIDQIG LWEADSEMEA LLSGRVGPSS GLTDLETVGQ SQVDDLLDMD WEGFATHLWG  300
EPAQSDLLQA GEPQTVTGSN SDELESFASW LLSDSCENTI N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23121185110B-MYB
1h8a_C5e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01003809G0130
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3563341e-163AK356334.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1033F20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558096.10.0myb-related protein P
SwissprotP278981e-101MYBP_MAIZE; Myb-related protein P
TrEMBLI1H6A70.0I1H6A7_BRADI; Uncharacterized protein
STRINGBRADI1G64687.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.11e-71myb domain protein 12
Publications ? help Back to Top
  1. Robbins ML,Sekhon RS,Meeley R,Chopra S
    A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize.
    Genetics, 2008. 178(4): p. 1859-74
    [PMID:18430921]
  2. Sidorenko L,Chandler V
    RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene.
    Genetics, 2008. 180(4): p. 1983-93
    [PMID:18845841]
  3. Robbins ML,Wang P,Sekhon RS,Chopra S
    Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism.
    PLoS ONE, 2009. 4(12): p. e8231
    [PMID:20011605]
  4. Rhee Y,Sekhon RS,Chopra S,Kaeppler S
    Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize.
    Genetics, 2010. 186(3): p. 843-55
    [PMID:20823340]
  5. Morohashi K, et al.
    A genome-wide regulatory framework identifies maize pericarp color1 controlled genes.
    Plant Cell, 2012. 24(7): p. 2745-64
    [PMID:22822204]