PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003507G0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 295aa    MW: 31738.3 Da    PI: 5.422
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003507G0040genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ede+lv +++++G g W + +++ g++R++k+c++rw++yl
  PH01003507G0040 14 RGAWTAMEDEILVSYINKHGEGKWGSLPKRAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding50.83.7e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el++++++ lG++ W++Ia +++ gRt++++k++w++ 
  PH01003507G0040  67 RGNISDDEEELIIRLHRILGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111
                      78999*****************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.784961IPR017930Myb domain
SuperFamilySSF466895.35E-2812108IPR009057Homeodomain-like
SMARTSM007176.8E-141363IPR001005SANT/Myb domain
PfamPF002491.7E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-221568IPR009057Homeodomain-like
CDDcd001671.71E-111661No hitNo description
PROSITE profilePS5129424.25262116IPR017930Myb domain
SMARTSM007172.2E-1566114IPR001005SANT/Myb domain
PfamPF002494.9E-1467111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2369115IPR009057Homeodomain-like
CDDcd001672.14E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRKPCCSKE GLNRGAWTAM EDEILVSYIN KHGEGKWGSL PKRAGLKRCG KSCRLRWLNY  60
LRPGIKRGNI SDDEEELIIR LHRILGNRWS LIAGRLPGRT DNEIKNYWNT TLGKRVQGNT  120
NNSCSNFQAI APSKCGPKLQ DSSDAGGPEA AHRRSPAPDT SPIRTKARRC TRVLIAAPTT  180
TSHGRPPENV VGHDDHAEEM AAAGQQDFAG DYLSIGSIDL DFDGIELSFL SPWRGDAAAL  240
TDGSVVGADG DHQFGVGEAE ADLEELLGLG AGGDDDDGDQ GVPSLGDLDQ LPWL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01003507G0040
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD886191e-121D88619.1 Oryza sativa mRNA for OSMYB3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561552.11e-104transcription repressor MYB6
SwissprotP102908e-61MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A0Q3HEZ41e-103A0A0Q3HEZ4_BRADI; Uncharacterized protein
STRINGSb01g032770.18e-87(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.13e-62MYB family protein
Publications ? help Back to Top
  1. Chen B,Wang X,Hu Y,Wang Y,Lin Z
    Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco.
    Mol. Biotechnol., 2004. 26(3): p. 187-92
    [PMID:15004287]
  2. Paz-Ares J,Ghosal D,Saedler H
    Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus.
    EMBO J., 1990. 9(2): p. 315-21
    [PMID:2303027]
  3. Cone KC,Burr FA,Burr B
    Molecular analysis of the maize anthocyanin regulatory locus C1.
    Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5
    [PMID:3025847]
  4. Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H
    The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators.
    EMBO J., 1987. 6(12): p. 3553-8
    [PMID:3428265]
  5. Scheffler B, et al.
    Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene.
    Mol. Gen. Genet., 1994. 242(1): p. 40-8
    [PMID:7904044]
  6. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]
  7. Singer T,Gierl A,Peterson PA
    Three new dominant C1 suppressor alleles in Zea mays.
    Genet. Res., 1998. 71(2): p. 127-32
    [PMID:9717435]