PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003180G0140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 328aa    MW: 35295.9 Da    PI: 6.4979
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003180G0140genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.96.2e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  PH01003180G0140 14 RGLWCPEEDEKLMNHIAKYGHGCWSSVPKIAGLERCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding53.26.9e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  PH01003180G0140  67 RGTFSQEEEDLIIHLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                      899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.36961IPR017930Myb domain
SuperFamilySSF466895.62E-2912108IPR009057Homeodomain-like
SMARTSM007171.3E-101363IPR001005SANT/Myb domain
PfamPF002491.9E-131461IPR001005SANT/Myb domain
CDDcd001674.24E-101761No hitNo description
PROSITE profilePS5129426.98862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2665116IPR009057Homeodomain-like
SMARTSM007175.1E-1666114IPR001005SANT/Myb domain
PfamPF002496.9E-1667111IPR001005SANT/Myb domain
CDDcd001672.98E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWCPE EDEKLMNHIA KYGHGCWSSV PKIAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIH LHSMLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKKLRERG  120
IDPVTHKPFA EAAGARAGGA ATTSSACRAV FRDAELIPTT TPVPAVEPML DGLKVPPDWP  180
VSFTGNGMPS SLSGYEAPSL QAGCAFDLDA LQHCGAIPAP VVPSASSSST LTSMAGLSPA  240
AADAEQCNNI AGANLPWLEL GPNNAVAGHV DHYAGALDEL RWSDYFDGAF QATATQSALQ  300
GQCVYGGGKE IDDDAVQFDV HGLSNWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01003180G0140
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0365351e-165BT036535.2 Zea mays full-length cDNA clone ZM_BFb0120O20 mRNA, complete cds.
GenBankBT0410771e-165BT041077.1 Zea mays full-length cDNA clone ZM_BFc0171O14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020150799.11e-149transcription repressor MYB6-like
TrEMBLA0A0A9ASW41e-167A0A0A9ASW4_ARUDO; Uncharacterized protein
STRINGMLOC_37780.31e-148(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.12e-75myb domain protein 50