PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002868G0200
Common NamePH01B001E05.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 311aa    MW: 34205.7 Da    PI: 7.0631
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002868G0200genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  PH01002868G0200 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.96.2e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+ +++++  +lG++ W++Ia++++  Rt++++k++w+++l
  PH01002868G0200  67 RGNFTPHEEGIIIHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.029965IPR017930Myb domain
SuperFamilySSF466891.18E-2911108IPR009057Homeodomain-like
SMARTSM007171.4E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001678.65E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2365117IPR009057Homeodomain-like
SMARTSM007171.4E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.5866116IPR017930Myb domain
PfamPF002494.1E-1367112IPR001005SANT/Myb domain
CDDcd001674.19E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MRRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PINTGLMRCS KSCRLRWTNY  60
LRSGIKRGNF TPHEEGIIIH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKRLKKHQ  120
AMGAIFASSS SAESTNPTTA GHVLDHHHMI TTSSSKVDSY ARGSACSNNP EVAQIITGRS  180
PFAAGSVDAD CSSSSYASSM DNISKLLNGF MESSPPQNAG ADVKPGIIEV NPLLSFDRMS  240
GAGAELTLTA VQQQQPASLL DECCYNEIET KQQQHQVPLS SIEKWLFDEA AEQVAELMDL  300
SHGCCSVPML F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002868G0200
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0926810.0FP092681.1 Phyllostachys edulis cDNA clone: bphyem110c07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808268.11e-140transcription factor MYB30-like
SwissprotB3VTV73e-97MYB60_VITVI; Transcription factor MYB60
TrEMBLL0P1U90.0L0P1U9_9POAL; PH01B001E05.10 protein
STRINGSi026651m1e-136(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-81myb domain protein 60
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]