PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01002830G0260 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 127aa MW: 13783.5 Da PI: 10.2212 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 60.8 | 1.7e-19 | 21 | 55 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+tt+Tp+WR gp g+++LCnaCG++yrkk++ PH01002830G0260 21 CVECRTTTTPMWRGGPTGPRSLCNACGIRYRKKRR 55 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.861 | 15 | 51 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.0E-15 | 15 | 66 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 7.13E-14 | 18 | 58 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 4.3E-16 | 19 | 56 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 2.03E-13 | 20 | 56 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 21 | 46 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 2.4E-17 | 21 | 55 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MGSSDRKVDG IGVVEEGRRS CVECRTTTTP MWRGGPTGPR SLCNACGIRY RKKRRQELGQ 60 DQKQPQQHRG EATTEVKEGK DSNSSSSSSS SNLQVVQKRR LLMGVEEAAL LLMTLSSPHA 120 STLLHG* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01002830G0260 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP096799 | 0.0 | FP096799.1 Phyllostachys edulis cDNA clone: bphylf042b12, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003567660.1 | 2e-59 | GATA transcription factor 23 | ||||
TrEMBL | A0A0D9V0K9 | 4e-59 | A0A0D9V0K9_9ORYZ; Uncharacterized protein | ||||
STRING | LPERR01G13070.2 | 7e-60 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49300.1 | 1e-20 | GATA transcription factor 16 |