PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002772G0250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 267aa    MW: 28121.4 Da    PI: 7.0336
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002772G0250genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.4e-18546143
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
                     +g+W++eEdell +av+++G+++W+ I+ +++ gR++k+c++r
  PH01002772G0250  5 KGSWSPEEDELLRRAVARHGPRNWSVISGEIP-GRSGKSCRLR 46
                     799*****************************.********98 PP

2Myb_DNA-binding60.43.9e-195296147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r ++T+eEd l+v a++++G++ W+tIar +  gRt++++k++w++ 
  PH01002772G0250 52 RRAFTPEEDALIVAAHTKYGNK-WATIARLLD-GRTDNSVKNHWNST 96
                     678*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.416145IPR017930Myb domain
SuperFamilySSF466891.06E-27293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-16346IPR009057Homeodomain-like
SMARTSM007177.5E-14453IPR001005SANT/Myb domain
PfamPF002494.8E-17546IPR001005SANT/Myb domain
CDDcd001675.75E-15747No hitNo description
PROSITE profilePS5129424.60547101IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2048100IPR009057Homeodomain-like
PfamPF002495.1E-155296IPR001005SANT/Myb domain
CDDcd001671.76E-125497No hitNo description
SMARTSM007172.6E-115499IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRIKGSWSP EEDELLRRAV ARHGPRNWSV ISGEIPGRSG KSCRLRCPGV HRRAFTPEED  60
ALIVAAHTKY GNKWATIARL LDGRTDNSVK NHWNSTLRRN RRAAAAAAAA ANAVGPFPAS  120
STSFQSLYLT EGDEEDEDDD EASDDSVAVP LPAQPLAKRQ CVAAVGGPPA ANLEHRAPPP  180
DPPTSLSLSL PGACAEATAT TAAPAPKAAS VASEKAKLEQ DPWLKAVMRQ MITEEVQRQV  240
GMVYSLMASA TAQSNAGAGK GPDGQD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-314993103MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-3049957157MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-3049957157MYB PROTO-ONCOGENE PROTEIN
1mse_C9e-314993103C-Myb DNA-Binding Domain
1msf_C9e-314993103C-Myb DNA-Binding Domain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002772G0250
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126132e-87CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639574.28e-96transcription factor MYB77
TrEMBLA0A0E0L1C21e-98A0A0E0L1C2_ORYPU; Uncharacterized protein
STRINGOPUNC05G11020.12e-99(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-45myb domain protein 73