PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PH01002771G0280

Organism

Phyllostachys heterocycla

Taxonomic ID

38705

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys

Family

bZIP

Protein Properties

Length: 178aa MW: 19389.9 Da PI: 8.5063

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PH01002771G0280	genome	ICBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	30.3	9.4e-10	77	124	4	51
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 k++r+ NReA r++R++Kka ++Lee+v +L a N++L k+l+ PH01002771G0280 77 PKKARKPLGNREAVRKYREKKKAHAARLEEEVRKLRAVNQQLLKRLQG 124 5999***************************************99974 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	2.7E-14	72	142	No hit	No description
SMART	SM00338	3.3E-10	74	141	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.002	76	142	IPR004827	Basic-leucine zipper domain
Pfam	PF07716	3.6E-11	77	131	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	4.0E-7	78	124	No hit	No description
CDD	cd14686	2.40E-11	86	133	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
MDNGELDVSS QVIFSNPETP PASLDDFLWN TTTTCTHTHT CNPPGPSATA HTHTCHHTHT 60 HVFSTDDDSC GSDKAKPKKA RKPLGNREAV RKYREKKKAH AARLEEEVRK LRAVNQQLLK 120 RLQGQAALEA EVARLRTLLV DVRAKIDGAL GSYPFQMPCG AGNALSCDGM AQCFLGK*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269\|PubMed:20479230, ECO:0000269\|PubMed:26306426}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PH01002771G0280

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by zinc deficiency. {ECO:0000269\|PubMed:20479230}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015619735.1	1e-78	basic leucine zipper 23-like
Swissprot	Q8VY76	2e-59	BZP19_ARATH; Basic leucine zipper 19
TrEMBL	A0A0E0BF26	3e-81	A0A0E0BF26_9ORYZ; Uncharacterized protein
TrEMBL	A0A0P0XYV6	2e-81	A0A0P0XYV6_ORYSJ; Os11g0139500 protein
STRING	LPERR12G02240.1	2e-80	(Leersia perrieri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP20947	5	7

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35040.1	4e-44	bZIP family protein

Publications ? help Back to Top
Azevedo H, et al. Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply. Genom Data, 2016. 7: p. 256-8 [PMID:26981422] Castro PH, et al. Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants. Sci Rep, 2017. 7(1): p. 3806 [PMID:28630437] Henriques AR,Farias DDR,Costa de Oliveira A Identification and characterization of the bZIP transcription factor involved in zinc homeostasis in cereals. Genet. Mol. Res., 2017. [PMID:28671251] Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE F-group bZIPs in barley-a role in Zn deficiency. Plant Cell Environ., 2017. 40(11): p. 2754-2770 [PMID:28763829] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]