PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01002755G0230 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 105aa MW: 11303.1 Da PI: 11.0338 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.3 | 2.4e-29 | 43 | 92 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+ + rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++g+lye++s PH01002755G0230 43 RIEDATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPRGRLYEFAS 92 8***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.1E-36 | 34 | 93 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.857 | 34 | 94 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.4E-27 | 36 | 94 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 36 | 90 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-29 | 36 | 56 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.3E-27 | 43 | 90 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.64E-32 | 44 | 92 | No hit | No description |
PRINTS | PR00404 | 2.1E-29 | 56 | 71 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-29 | 71 | 92 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MVATAAAAAR GEGQQIVAAP TPADSTVKAV KKTGRRGRRE MRRIEDATSR QVTFSKRRSG 60 LLKKAFELSV LCDAEVALIV FSPRGRLYEF ASATEYVRGL ISVC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 6e-18 | 36 | 93 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_B | 6e-18 | 36 | 93 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_C | 6e-18 | 36 | 93 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_D | 6e-18 | 36 | 93 | 2 | 59 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01002755G0230 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP098509 | 1e-141 | FP098509.1 Phyllostachys edulis cDNA clone: bphylf003i12, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_026380236.1 | 3e-30 | MADS-box protein SOC1-like isoform X1 | ||||
Swissprot | A2Z9Q7 | 1e-30 | MAD56_ORYSI; MADS-box transcription factor 56 | ||||
Swissprot | P0C5B2 | 1e-30 | MAD56_ORYSJ; MADS-box transcription factor 56 | ||||
TrEMBL | A0A1E5VTG7 | 4e-36 | A0A1E5VTG7_9POAL; MADS-box protein SOC1 | ||||
STRING | Traes_1BL_F1D5BF5F8.2 | 1e-31 | (Triticum aestivum) | ||||
STRING | Traes_6DS_2BAD7A60A.1 | 9e-32 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP129 | 38 | 398 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11880.1 | 6e-28 | AGAMOUS-like 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|