PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002736G0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 427aa    MW: 47126.8 Da    PI: 6.6229
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002736G0020genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l + ++++G g+W+ +++  g+ R++k+c++rw++yl
  PH01002736G0020 14 KGLWSPEEDEKLMNHITKHGHGCWSIVPKLAGLQRCGKSCRLRWLNYL 61
                     678*******************************************97 PP

2Myb_DNA-binding414.3e-1367110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE +l +++++ lG++ W+ I+ +++ gRt++++k+ w++
  PH01002736G0020  67 RGAFSQEEVDLVIELHAVLGNR-WSQISTRLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.382965IPR017930Myb domain
SuperFamilySSF466897.03E-2812108IPR009057Homeodomain-like
SMARTSM007176.7E-121363IPR001005SANT/Myb domain
PfamPF002496.6E-151461IPR001005SANT/Myb domain
CDDcd001671.64E-101761No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2365116IPR009057Homeodomain-like
SMARTSM007171.5E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129419.58766116IPR017930Myb domain
PfamPF002496.6E-1267110IPR001005SANT/Myb domain
CDDcd001672.46E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSIV PKLAGLQRCG KSCRLRWLNY  60
LRPDLKRGAF SQEEVDLVIE LHAVLGNRWS QISTRLPGRT DNEIKNLWNS CIKKKLRQKG  120
IDPNTHKPLT EIHRSKAAPT ISTERTSDSS DVDPSSGGAL GNLSHLLSET AQSPELLPVL  180
GKHHTETPSL ARLKVPPKEL FLDQIASGHE NLPSCRSSGP IPNFPFQQLF CYSNEFSSRD  240
GGSTNSLWFS QNESSVSTIS TVMPPVSPST LSTSTGLNLS PDNPHSGGTG IRSAQFYWDT  300
TNPTSSSSTG SSGSNGLGFE LQTTSSLLEN SVFPWTGLAP DKDSQVHLEE ELKWPDLLDG  360
TFPETSAAMQ NLSQSLYEDV VKAESQFNME GLCAAWSQNL QTQLLHVVTD MYDKDLQRMS  420
LSFENI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002736G0020
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM7479400.0HM747940.1 Phyllostachys edulis MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457686.10.0transcription factor MYB61 isoform X1
TrEMBLE5G3F80.0E5G3F8_9POAL; MYB protein
STRINGSb03g011640.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.16e-85myb domain protein 61