PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002707G0220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 304aa    MW: 33482.3 Da    PI: 6.5654
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002707G0220genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-141865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+  + ++G g+W+++++   + R++k+c++rw +yl
  PH01002707G0220 18 RGLWSPEEDEKLYSHIIRYGVGCWSSVPKLAALERCGKSCRLRWINYL 65
                     788*******************************************97 PP

2Myb_DNA-binding51.91.8e-1671115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E+el++ ++k lG++ W+ Ia+ ++ gRt++++k++w++ 
  PH01002707G0220  71 RGSFSQQEEELIISLHKILGNR-WSQIASQLP-GRTDNEIKNFWNSC 115
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-231368IPR009057Homeodomain-like
PROSITE profilePS5129417.6981365IPR017930Myb domain
SuperFamilySSF466891.54E-2815112IPR009057Homeodomain-like
SMARTSM007174.8E-121767IPR001005SANT/Myb domain
PfamPF002496.2E-131865IPR001005SANT/Myb domain
CDDcd001677.24E-112165No hitNo description
PROSITE profilePS5129425.97266120IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2669120IPR009057Homeodomain-like
SMARTSM007175.4E-1670118IPR001005SANT/Myb domain
PfamPF002498.1E-1571115IPR001005SANT/Myb domain
CDDcd001679.79E-1273113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGREAVACSP KPKPKLRRGL WSPEEDEKLY SHIIRYGVGC WSSVPKLAAL ERCGKSCRLR  60
WINYLRPDLK RGSFSQQEEE LIISLHKILG NRWSQIASQL PGRTDNEIKN FWNSCLKKKL  120
RQRGIDPTTH KPLNDDGAGA ETHDDCKQLP ADYHCFSMAG AAGSDPLAPH SPVSSFDPLS  180
VTNVPTMEGS YGGATYSAYT GGGDSSSNSN SNSTWTCGGE PLPHMDMFGD AEPYPFDPAK  240
FSPWHQHHEP HLQQQHASVR LHDADAGGGG AASFPIRSLS RDLPESCFDL ARGALEDEFS  300
VDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141203108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115121LKKKLRQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002707G0220
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0925930.0FP092593.1 Phyllostachys edulis cDNA clone: bphylf046j05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968898.11e-155myb-related protein Hv33
RefseqXP_004968899.11e-155myb-related protein Hv33
TrEMBLK3XJZ71e-154K3XJZ7_SETIT; Uncharacterized protein
STRINGSi002220m1e-154(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.18e-72myb domain protein 86