PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002704G0220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 314aa    MW: 35029.4 Da    PI: 6.8536
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002704G0220genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.42.5e-111046744
                     HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     +Ed++l++ v+++G ++W tIar ++ gR++ qc  rw
  PH01002704G0220 10 QEDKKLIQMVNKHGQKHWPTIARAIP-GRSATQCLVRW 46
                     69************************.*******9999 PP

2Myb_DNA-binding40.37.1e-135698145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     + +W++eE+++l++a++ +G++ W    ++++ gRt   +k++w+
  PH01002704G0220 56 KEAWSQEEELRLIRAHQIYGNK-WCEMVKHFP-GRTNHAIKEHWR 98
                     579*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.049150IPR017930Myb domain
SMARTSM007172.1E-5552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-171058IPR009057Homeodomain-like
SuperFamilySSF466892.68E-231097IPR009057Homeodomain-like
CDDcd001671.02E-101047No hitNo description
PfamPF139211.1E-121067No hitNo description
PROSITE profilePS5129420.21951105IPR017930Myb domain
SMARTSM007173.2E-1155103IPR001005SANT/Myb domain
CDDcd001675.97E-115898No hitNo description
Gene3DG3DSA:1.10.10.603.5E-1859105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSVDKTKLIQ EDKKLIQMVN KHGQKHWPTI ARAIPGRSAT QCLVRWKFSL DPGINKEAWS  60
QEEELRLIRA HQIYGNKWCE MVKHFPGRTN HAIKEHWRGP MKRKLDSYLA SGLLEQFPGL  120
PETPSVPQNS DSDNLKDIEG SSHTNRQSSK SKLGLTELGE NADTSEGESS DFMYAGELDA  180
PSAKASERMM ARSKQRVRTR RRLDFLSSPV ELKVSTAAVN SQRPLQKRKQ MRPAFDNISP  240
SNVLQDISPE VPSECTDKAL SPADTYQPSD VHSSETADPC SLEVHQADVS DLLDMPYCDG  300
LMIVPPGSPH DGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-261010713110B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002704G0220
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756287.11e-136transcription factor MYB3R-2 isoform X2
TrEMBLA0A0Q3F4511e-135A0A0Q3F451_BRADI; Uncharacterized protein
STRINGBRADI3G10067.11e-133(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP142631723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.13e-43myb domain protein 3r-4