PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002611G0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 230aa    MW: 24362.4 Da    PI: 6.1053
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002611G0010genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.77.2e-10646948
                     HHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  9 dellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     d+ l  +++++G+g +W + +++ g++R++k+c++rw++yl
  PH01002611G0010  6 DDALRAYIQRHGTGgSWISLPKKAGLRRCGKSCRLRWLNYL 46
                     678999*********************************97 PP

2Myb_DNA-binding42.81.2e-135395246
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     g +T eEd +++ +   lG++ W++Ia+++  +Rt++++k++w++
  PH01002611G0010 53 GGFTDEEDAIIISLYSTLGSK-WSLIASHLE-RRTDNDVKNYWNT 95
                     569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.445146IPR017877Myb-like domain
SMARTSM007171.5248IPR001005SANT/Myb domain
CDDcd001677.32E-4246No hitNo description
Gene3DG3DSA:1.10.10.604.9E-18553IPR009057Homeodomain-like
PfamPF002491.7E-8646IPR001005SANT/Myb domain
SuperFamilySSF466892.14E-2132103IPR009057Homeodomain-like
PROSITE profilePS5129421.89747101IPR017930Myb domain
SMARTSM007172.2E-125199IPR001005SANT/Myb domain
PfamPF002492.8E-125395IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2354101IPR009057Homeodomain-like
CDDcd001671.07E-105597No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
TSVSSDDALR AYIQRHGTGG SWISLPKKAG LRRCGKSCRL RWLNYLRPDI RHGGFTDEED  60
AIIISLYSTL GSKWSLIASH LERRTDNDVK NYWNTKLKKR LAAEASSIPS LPFLPLPAPA  120
PAPVLAPVPT HPSLLPLAIP TVKTETYTCD DFLVSAELQD PFAGCADADG STSASAASSA  180
SNRSADNGTA DGGGIFPDFC MGSDLGGAAA VDQFLGGYYY PLDPSLSLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-17410113108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002611G0010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3764091e-100AK376409.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3123B18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455023.14e-85transcription factor RAX2
TrEMBLA0A3L6SQD06e-86A0A3L6SQD0_PANMI; Transcription factor RAX2-like
STRINGSb03g003120.12e-84(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.13e-51MYB family protein