PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002276G0160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 329aa    MW: 35201.4 Da    PI: 7.359
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002276G0160genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++q+G g+W++ +++ g+ R++k+c++rw +yl
  PH01002276G0160 14 KGPWTPEEDQKLLSYIEQHGHGCWRSLPSKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.26.8e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  PH01002276G0160  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.544961IPR017930Myb domain
SuperFamilySSF466896.74E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-141363IPR001005SANT/Myb domain
PfamPF002499.9E-171461IPR001005SANT/Myb domain
CDDcd001672.42E-111661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002493.6E-1667112IPR001005SANT/Myb domain
CDDcd001674.96E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRSPCCEKE GLKKGPWTPE EDQKLLSYIE QHGHGCWRSL PSKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKPRS DVAGAGGGAT GAAGAQHAKA AAHLSHTAQW ESARLEAEAR LAREAKLRAL  180
AASASAPHLP PPAAPGLDSP TSTLSFSESA ALASVLEAHS ATAAGRAAMQ PMQAYEEACK  240
EQHWGDADAA DAGFAGVGFT GLLLDGSLNQ NPRSTARDDA EADVGLQETE EEKNYWNSIL  300
NLVNSSSASL STSVVVPAPE AYSPAPEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtFunctions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002276G0160
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519180.0JF951918.1 Triticum aestivum clone TaMYB16 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635111.10.0transcription factor MYB106
SwissprotQ9LE631e-116MY106_ARATH; Transcription factor MYB106
TrEMBLI1PLX90.0I1PLX9_ORYGL; Uncharacterized protein
STRINGORGLA04G0119800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.19e-89myb domain protein 16