PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002184G0220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 326aa    MW: 34980.1 Da    PI: 4.3727
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002184G0220genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.99.8e-13244648
                     HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     ++Ed +l+ +++++G  +W++ +++ g+ R++k+c++rw +yl
  PH01002184G0220  2 PQEDMRLIAYIQKHGHANWRALPKKAGLLRCGKSCRLRWINYL 44
                     68*************************99************97 PP

2Myb_DNA-binding46.21.1e-145095148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T +E+e +++++ +lG++ W++I ++++ gRt++++k+ w+++l
  PH01002184G0220 50 RGNFTVDEEETIIKLHGLLGNK-WSKITSCLP-GRTDNEIKNVWNTHL 95
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.97144IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-20251IPR009057Homeodomain-like
SuperFamilySSF466893.91E-25291IPR009057Homeodomain-like
PfamPF002495.4E-11244IPR001005SANT/Myb domain
SMARTSM007172.8E-4246IPR001005SANT/Myb domain
CDDcd001674.58E-8244No hitNo description
PROSITE profilePS5129422.9314599IPR017930Myb domain
SMARTSM007171.8E-124997IPR001005SANT/Myb domain
PfamPF002499.9E-135095IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-245299IPR009057Homeodomain-like
CDDcd001672.24E-95295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MPQEDMRLIA YIQKHGHANW RALPKKAGLL RCGKSCRLRW INYLRPDLKR GNFTVDEEET  60
IIKLHGLLGN KWSKITSCLP GRTDNEIKNV WNTHLKKKVA QREQQQQQKP GAAKNNGDAD  120
TPVPSSSASS STTTTTNNGT SGGEQCGTSK EPDMIDILSP LEPNIDISDM LVDAPTDALP  180
AAPMSPSPCS SSSLTTCIGG GVEELLELLE IDIEPDIWSI IDGADAPDVS GARLQGDGDA  240
TVPYCTAAIA ASTSQEEEGK EWWLENLEKE LGLWGPTDES QAHVDPPGQM GYLVGTEGDP  300
VSTYFQSGAT AALQLQELGS LATPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C7e-2339910105C-Myb DNA-Binding Domain
1msf_C7e-2339910105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002184G0220
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647724.11e-129PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-118MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA2X8J61e-130A2X8J6_ORYSI; Uncharacterized protein
STRINGONIVA02G31530.11e-131(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.13e-53myb domain protein 63
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]