PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002139G0430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 290aa    MW: 32202.8 Da    PI: 8.4439
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002139G0430genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.5e-154491148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +lv  v+++G ++W++ a+  g++Rt+k+c++rw +yl
  PH01002139G0430 44 KGPWTEQEDVQLVWFVRLFGERRWDLLAKVSGLKRTGKSCRLRWVNYL 91
                     79********************************************97 PP

2Myb_DNA-binding54.62.4e-1797142148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr T++E+ l++++++q+G++ W++Iar+++ gRt++++k++w++++
  PH01002139G0430  97 RGRITADEERLILQLHAQWGSR-WSRIARKLP-GRTDNEIKNYWRTHM 142
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.2433991IPR017930Myb domain
SuperFamilySSF466898.07E-2841138IPR009057Homeodomain-like
SMARTSM007175.2E-134393IPR001005SANT/Myb domain
PfamPF002492.2E-134491IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-204598IPR009057Homeodomain-like
CDDcd001671.15E-84691No hitNo description
PROSITE profilePS5129425.68992146IPR017930Myb domain
SMARTSM007173.8E-1696144IPR001005SANT/Myb domain
PfamPF002499.0E-1597141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2399145IPR009057Homeodomain-like
CDDcd001672.85E-10101142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MVVKAKKIAV AAEKRGGRGR GVVEVEETMS CNDDSSGGGG GMRKGPWTEQ EDVQLVWFVR  60
LFGERRWDLL AKVSGLKRTG KSCRLRWVNY LHPSLKRGRI TADEERLILQ LHAQWGSRWS  120
RIARKLPGRT DNEIKNYWRT HMRKKAQEEK KKRAAASASP SSSSSSTTTS CSASLNNGTS  180
STSSAVTELV QESSSGDEAE EATTAASQQQ QQQQQPRDQQ ENYYIMDQLW NEIAAAEAAT  240
SYAEGWGAGH VVAAEPASSM PSPVWEFSAD FSLWRIDDEE YYKKMLDAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27441464105MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-274414658159MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-274414658159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-27441464105C-Myb DNA-Binding Domain
1msf_C2e-27441464105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002139G0430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519041e-121JF951904.1 Triticum aestivum clone TaMYB20 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020156198.11e-97myb-related protein MYBAS2-like
SwissprotQ4JL763e-68MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA0A0E0KXR01e-103A0A0E0KXR0_ORYPU; Uncharacterized protein
STRINGOPUNC05G00970.11e-104(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.33e-63myb domain protein 59
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]