PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002092G0300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 387aa    MW: 42365.7 Da    PI: 4.8134
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002092G0300genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++lv     +G  +W+ +++  g+ R++k+c++rw +yl
  PH01002092G0300 14 RGPWTAEEDQKLVSFLFSHGHCCWRIVPKLAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding47.83.3e-1570111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +++E++l +d+++qlG++ W++Ia++++ gRt++++k+ w+++
  PH01002092G0300  70 LSEDEEKLVIDLHAQLGNR-WSKIAARLP-GRTDNEIKNLWNTH 111
                      589****************.*********.***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-20563IPR009057Homeodomain-like
PROSITE profilePS5129414.413961IPR017930Myb domain
SuperFamilySSF466895.24E-2611108IPR009057Homeodomain-like
SMARTSM007172.0E-121363IPR001005SANT/Myb domain
PfamPF002495.5E-141461IPR001005SANT/Myb domain
CDDcd001672.29E-91661No hitNo description
PROSITE profilePS5129424.89562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-2464117IPR009057Homeodomain-like
SMARTSM007178.5E-1366114IPR001005SANT/Myb domain
PfamPF002491.7E-1370111IPR001005SANT/Myb domain
CDDcd001671.98E-1071112No hitNo description
Gene3DG3DSA:1.10.510.109.8E-5264340No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGRQPCCDKV GLKRGPWTAE EDQKLVSFLF SHGHCCWRIV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEDEEKLVID LHAQLGNRWS KIAARLPGRT DNEIKNLWNT HIKKKLKKMG  120
IDPITHQPVA PVQSDPLKIQ QEQQRRDPPE AQEHLDEAKP SSQEPAGSGA GAYDEEAAPV  180
SAEPKGVTCS TSSASASASA VSPSCSSSSA SASVATPGAD VEWPDPIDLF EVDGVMDMDW  240
DSILSGCGGD GGGISVDLFD HYSDVGFDQE VKKLHQEKQL CMMVDKDLGS TYDRVELEEM  300
VQVALLCTQY YPSHRPKMSE VIRMLEGDGL TEKWEASQNV DTSKSISSEL LSPKFMDFAA  360
DESSLGPEAM ELSGGRTRQQ EASISI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002092G0300
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1087091e-144AK108709.1 Oryza sativa Japonica Group cDNA clone:002-150-A10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953828.11e-125protein ODORANT1
TrEMBLK3Z1081e-124K3Z108_SETIT; Uncharacterized protein
STRINGSi020225m1e-125(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.16e-82myb domain protein 20