PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002082G0250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 285aa    MW: 30453.9 Da    PI: 6.8782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002082G0250genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEd  l+++++ +G g+W++ ++  g+ R++k+c++rw++yl
  PH01002082G0250 14 RGRWTAEEDGVLARYIADHGEGSWRSLPKNAGLSRCGKSCRLRWLNYL 61
                     8*********************************************97 PP

2Myb_DNA-binding52.31.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE++ +++++  lG++ W++Iar ++ gRt++++k++w+++l
  PH01002082G0250  67 RGNISKEEEDTIINLHSSLGNR-WSLIARQLP-GRTDNEIKNYWNTHL 112
                      7899******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.555961IPR017930Myb domain
SuperFamilySSF466893.11E-2811108IPR009057Homeodomain-like
SMARTSM007171.8E-111363IPR001005SANT/Myb domain
PfamPF002492.0E-141461IPR001005SANT/Myb domain
CDDcd001676.21E-91661No hitNo description
PROSITE profilePS5129425.00962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2465116IPR009057Homeodomain-like
SMARTSM007176.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1467112IPR001005SANT/Myb domain
CDDcd001679.20E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRAPCCDKV GLKRGRWTAE EDGVLARYIA DHGEGSWRSL PKNAGLSRCG KSCRLRWLNY  60
LRTDIKRGNI SKEEEDTIIN LHSSLGNRWS LIARQLPGRT DNEIKNYWNT HLSRQIHTFW  120
GAPADGHAAA AVTIDIRVLP GGRTSRRPVV DSKKPAGAGT EAVTVGHSNS TGAETAAPSP  180
MASQSDELRL HSVVVERKKQ AGNMSAAPSS EGSSGTMGLS PTGIGQWEAG SEIRDGGGPV  240
VGRAEEDDLS GVDWEGLAAQ LWGDVSLGSE LESLARWLMS DSDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-23121185110B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002082G0250
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629329.13e-87myb-related protein P
SwissprotP278981e-72MYBP_MAIZE; Myb-related protein P
TrEMBLA0A0E0KCP64e-90A0A0E0KCP6_ORYPU; Uncharacterized protein
STRINGOPUNC03G13890.16e-91(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.11e-67myb domain protein 12
Publications ? help Back to Top
  1. Robbins ML,Sekhon RS,Meeley R,Chopra S
    A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize.
    Genetics, 2008. 178(4): p. 1859-74
    [PMID:18430921]
  2. Sidorenko L,Chandler V
    RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene.
    Genetics, 2008. 180(4): p. 1983-93
    [PMID:18845841]
  3. Robbins ML,Wang P,Sekhon RS,Chopra S
    Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism.
    PLoS ONE, 2009. 4(12): p. e8231
    [PMID:20011605]
  4. Rhee Y,Sekhon RS,Chopra S,Kaeppler S
    Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize.
    Genetics, 2010. 186(3): p. 843-55
    [PMID:20823340]
  5. Morohashi K, et al.
    A genome-wide regulatory framework identifies maize pericarp color1 controlled genes.
    Plant Cell, 2012. 24(7): p. 2745-64
    [PMID:22822204]