PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002000G0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 236aa    MW: 25734.1 Da    PI: 8.7051
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002000G0040genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv +++ +G g+W++ ++  g+ R++k+c++rw +yl
  PH01002000G0040 14 KGAWTKEEDQRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.31.2e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T  E el+++ + +lG++ W++Ia  ++ gRt++++k++w+++
  PH01002000G0040  67 RGNFTDHENELIIRHHSLLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.056961IPR017930Myb domain
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
SuperFamilySSF466892.32E-2813108IPR009057Homeodomain-like
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001677.21E-121661No hitNo description
PROSITE profilePS5129424.39762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2565116IPR009057Homeodomain-like
SMARTSM007175.9E-1466114IPR001005SANT/Myb domain
PfamPF002497.1E-1367111IPR001005SANT/Myb domain
CDDcd001671.37E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIR AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDHENELIIR HHSLLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLARG  120
IDPQTHRPLL SGTTDAASNV PAKAAAVFAV TKPPAPVESS DDGSSGATST GEPRCPDLNL  180
DLSVGPPPAD TPTSQPVCLC YHLGFRGGEA CSCQAGSASP QGFRYFRPLE EGQYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28141167108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002000G0040
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0668341e-162AK066834.1 Oryza sativa Japonica Group cDNA clone:J013083O13, full insert sequence.
GenBankAK1040531e-162AK104053.1 Oryza sativa Japonica Group cDNA clone:001-023-G03, full insert sequence.
GenBankD886171e-162D88617.1 Oryza sativa mRNA for OSMYB1, complete cds.
GenBankEU8372461e-162EU837246.1 Oryza sativa Japonica Group clone KCS051A09 myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638107.11e-136transcription factor MYB8
SwissprotP813932e-94MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A287G8K91e-139A0A287G8K9_HORVV; Uncharacterized protein
TrEMBLQ069441e-139Q06944_HORVU; MybHv5
STRINGMLOC_71041.11e-139(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.14e-85myb domain protein 4
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]