PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001996G0370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 294aa    MW: 31222.2 Da    PI: 7.9513
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001996G0370genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEde+l  +v+++G   +W + +++ g++R++k+c++rw++yl
  PH01001996G0370 14 RGPWSPEEDEQLRSYVQRHGISgNWIALPQKAGLNRCGKSCRLRWLNYL 62
                     89******************889************************97 PP

2Myb_DNA-binding37.55.4e-1271111446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       T++Ed+ +  + +  G++ W+ Ia++++ gRt++++k++w++
  PH01001996G0370  71 YTEQEDQMICSLYNSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                      69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.409966IPR017930Myb domain
SuperFamilySSF466894.49E-2811109IPR009057Homeodomain-like
SMARTSM007171.6E-111364IPR001005SANT/Myb domain
PfamPF002493.2E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-241569IPR009057Homeodomain-like
CDDcd001671.15E-91662No hitNo description
SMARTSM007173.2E-1167115IPR001005SANT/Myb domain
PROSITE profilePS5129414.16667117IPR017930Myb domain
PfamPF002497.6E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2270116IPR009057Homeodomain-like
CDDcd001671.18E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRAPCCDKA RVKRGPWSPE EDEQLRSYVQ RHGISGNWIA LPQKAGLNRC GKSCRLRWLN  60
YLRPDIRHGG YTEQEDQMIC SLYNSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKATVA  120
VHPGGASGAS SAPATPPGTR SQCTSLQPAL SPAASASSSV TSSSGDICFA AMYPPHPQPQ  180
GLIHFDAPPS RKPQTELAPV PPATVALDVS GGWAPAPAAS VDGVTLDDVF LAELGGAGEQ  240
LLFPYGDQFG GFGGLQDKAT LELSACYFPN MAEMWAAFDH AHAKPQGLCG TLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25141177108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001996G0370
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084521e-153AK108452.1 Oryza sativa Japonica Group cDNA clone:002-143-C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654754.11e-129PREDICTED: transcription factor RAX1-like
TrEMBLJ3M9J11e-128J3M9J1_ORYBR; Uncharacterized protein
STRINGOB05G32650.11e-128(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-67myb domain protein 84