PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001991G0310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 317aa    MW: 36090.9 Da    PI: 8.3307
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001991G0310genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-1584131148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ed++lv+ v  +G ++W+ Ia   g++Rt+k+c++rw +yl
  PH01001991G0310  84 KGPWTEQEDLQLVCTVCSFGERRWDFIATVSGLNRTGKSCRLRWVNYL 131
                      79********************************************97 PP

2Myb_DNA-binding54.13.5e-17137182148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr+++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  PH01001991G0310 137 RGRMSPHEERLILELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 182
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.18379131IPR017930Myb domain
SMARTSM007172.1E-1283133IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-2883178IPR009057Homeodomain-like
PfamPF002493.1E-1484131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-1885138IPR009057Homeodomain-like
CDDcd001675.62E-986131No hitNo description
PROSITE profilePS5129425.552132186IPR017930Myb domain
SMARTSM007172.2E-16136184IPR001005SANT/Myb domain
PfamPF002496.6E-15137181IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-23139185IPR009057Homeodomain-like
CDDcd001671.05E-11139182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MESSVPMIIA DRKANAFHIR RTKKKYGRNQ IGTLRRFPFP MTGVHQASHP ETGAHKHTEE  60
EEQEDRLPAD TRVDMVTVRE ETRKGPWTEQ EDLQLVCTVC SFGERRWDFI ATVSGLNRTG  120
KSCRLRWVNY LHPGLKRGRM SPHEERLILE LHARWGNRWS RIARRLPGRT DNEIKNYWRT  180
HMRKKAQERK RNMSPSSSSS SLTYQSCHPE TPSIIGIDEQ ELHGGSSSCI TSILKGTPAD  240
MDGYPMDQIW MEIEAPEAPT GLGFDEGKDN ACGSLSGPLL PSPMWDHYCP EACWKMDGEI  300
KMAQQFGYSK GVGPCY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-26811861105MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-258118655159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-258118655159MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-26841864105C-Myb DNA-Binding Domain
1msf_C3e-26841864105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001991G0310
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8332820.0CT833282.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA120H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025877776.11e-152myb-related protein MYBAS2 isoform X2
SwissprotQ4JL761e-141MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA3CIJ41e-174A3CIJ4_ORYSJ; Uncharacterized protein
STRINGTRIUR3_16862-P11e-155(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.36e-72myb domain protein 59
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]