PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01001939G0040 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 180aa MW: 19830.3 Da PI: 9.8274 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.6 | 8.9e-33 | 77 | 132 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 ep+YVNaKQy++Il+RRq+Rak+e+++k +k+rkpylheSRh hAl+R+RgsgGrF PH01001939G0040 77 EPVYVNAKQYHGILRRRQSRAKAESQNKA-NKTRKPYLHESRHLHALKRARGSGGRF 132 8****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.1E-34 | 74 | 135 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.637 | 75 | 135 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.0E-27 | 77 | 132 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.9E-24 | 78 | 100 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 80 | 100 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.9E-24 | 109 | 132 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MVLDFVTYCI FVPFAGSEFD KPHMQPDGET QAQVAYPYIG PYYGGIYGAY GGQRLVNAAL 60 MAMPPNSVPL ATDAVLEPVY VNAKQYHGIL RRRQSRAKAE SQNKANKTRK PYLHESRHLH 120 ALKRARGSGG RFVNTKAVEG KQDNKSVDKK DDGPVPSDKN YNSNETNTRI ESQNLGPTA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 3e-20 | 77 | 136 | 3 | 62 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01001939G0040 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015695809.1 | 8e-77 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q84JP1 | 2e-38 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A0E0EIX1 | 1e-75 | A0A0E0EIX1_9ORYZ; Uncharacterized protein | ||||
STRING | OMERI08G05480.1 | 2e-76 | (Oryza meridionalis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP16558 | 13 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 2e-37 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|