PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001925G0330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 248aa    MW: 27606 Da    PI: 8.0049
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001925G0330genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ lv  ++++G g+W++ ++  g+ R++k+c++rw +yl
  PH01001925G0330 14 KGPWTPEEDKVLVAHIQRFGHGNWRALPKQAGLPRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.84.5e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  PH01001925G0330  67 RGNFTKEEEDTIIQLHELLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.766961IPR017930Myb domain
SuperFamilySSF466898.07E-3210108IPR009057Homeodomain-like
SMARTSM007174.0E-131363IPR001005SANT/Myb domain
PfamPF002493.8E-141461IPR001005SANT/Myb domain
CDDcd001671.34E-101661No hitNo description
PROSITE profilePS5129425.94162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-2765116IPR009057Homeodomain-like
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PfamPF002494.1E-1667112IPR001005SANT/Myb domain
CDDcd001671.19E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTPE EDKVLVAHIQ RFGHGNWRAL PKQAGLPRCG KSCRLRWINY  60
LRPNIKRGNF TKEEEDTIIQ LHELLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLEPKA  120
QEREASGAKK HKPAAPKRES GGRRTDATTA PVSPERPVSS SVTDSSMASS VAEHGNTGSS  180
AFVKGESFTS GSEDFQIDES FWSETLSMPL DSYDVSVEPR DAFGADDMDF WLRTFMEAGD  240
VQDLPQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001925G0330
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0939540.0FP093954.1 Phyllostachys edulis cDNA clone: bphyem107b06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633465.11e-120transcription factor MYB4
RefseqXP_015692254.11e-120PREDICTED: LOW QUALITY PROTEIN: myb-related protein Myb4-like
SwissprotQ7XBH41e-121MYB4_ORYSJ; Transcription factor MYB4
TrEMBLA0A1D8F0K41e-164A0A1D8F0K4_9POAL; MYB protein
STRINGOB04G25860.11e-119(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.17e-78myb domain protein 15
Publications ? help Back to Top
  1. Park MR, et al.
    Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development.
    Plant Cell Environ., 2010. 33(12): p. 2209-30
    [PMID:20807373]
  2. Solt├ęsz A, et al.
    The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants.
    J. Appl. Genet., 2012. 53(2): p. 133-43
    [PMID:22246661]