PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01001655G0060 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 183aa MW: 19207.3 Da PI: 6.788 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.9 | 3.1e-58 | 33 | 129 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 vreqdrflPian+srimkk++Pan+ki+kd+ketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplk+yl+kyre+e PH01001655G0060 33 VREQDRFLPIANISRIMKKAIPANGKIAKDSKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKAYLQKYREME 126 69******************************************************************************************** PP NF-YB 95 gek 97 g++ PH01001655G0060 127 GDS 129 *97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.3E-54 | 32 | 137 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.02E-39 | 36 | 133 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.7E-27 | 39 | 103 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.7E-22 | 67 | 85 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 70 | 86 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.7E-22 | 86 | 104 | No hit | No description |
PRINTS | PR00615 | 1.7E-22 | 105 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MADAPASPGG GGGSHESGSP RGGGGGGGGG WGVREQDRFL PIANISRIMK KAIPANGKIA 60 KDSKETVQEC VSEFISFITS EASDKCQREK RKTINGDDLL WAMATLGFED YIEPLKAYLQ 120 KYREMEGDSK LSAKAGDGSV RKDAVGPHGG ASSSSAQGMG QQGAYNQGMG YMQPQYHNGD 180 ISN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 2e-49 | 31 | 124 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-49 | 31 | 124 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01001655G0060 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP098315 | 0.0 | FP098315.1 Phyllostachys edulis cDNA clone: bphylf037i08, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004961814.1 | 1e-103 | nuclear transcription factor Y subunit B | ||||
Refseq | XP_004961815.1 | 1e-103 | nuclear transcription factor Y subunit B | ||||
Refseq | XP_012700237.1 | 1e-103 | nuclear transcription factor Y subunit B | ||||
Swissprot | P25209 | 1e-102 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | A0A2T7ECR3 | 1e-102 | A0A2T7ECR3_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J02009.1.p | 1e-103 | (Panicum virgatum) | ||||
STRING | Si023400m | 1e-103 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 1e-68 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|