PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001622G0290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 319aa    MW: 33660 Da    PI: 9.2894
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001622G0290genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l ++v+++G+++W++ ++ ++ gR++k+c++rw + 
  PH01001622G0290 19 KGPWSPEEDDALQRLVARHGSRNWSLTSKSIP-GRSGKSCRLRWCNQ 64
                     79******************************.***********985 PP

2Myb_DNA-binding53.74.7e-1773115347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  PH01001622G0290  73 PFTPEEDDTILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 115
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.2181469IPR017930Myb domain
SuperFamilySSF466891.83E-3016112IPR009057Homeodomain-like
SMARTSM007172.5E-131867IPR001005SANT/Myb domain
PfamPF002491.4E-161964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-242072IPR009057Homeodomain-like
CDDcd001671.17E-132163No hitNo description
SMARTSM007171.7E-1470118IPR001005SANT/Myb domain
PROSITE profilePS5129420.33871120IPR017930Myb domain
PfamPF002491.5E-1473115IPR001005SANT/Myb domain
CDDcd001679.89E-1273116No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2373119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MAAACRGGGG GAKDVDRIKG PWSPEEDDAL QRLVARHGSR NWSLTSKSIP GRSGKSCRLR  60
WCNQLSPQVE HRPFTPEEDD TILRAHARFG NKWATIARLL SGRTDNAIKN HWNSTLKRKY  120
PSSASSSASV ADAGAADDAA DLARPLKRTS SDSHPGLCFS PGSPSGSDLS DSSHHSLPSV  180
MPSAATSHPQ QHVYRPVART VGVVVLPTPP PPATSLSLSL SLPGPDPPDP TPSEATPAAP  240
PPPLPAQPAP ASQMPPPMPF QLQNLAPAPF SGEFLAMMQE MIRIEVRNYM SGLDPRSPAD  300
GVHAAAAAKR VMGMAKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-38181193104MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-38181193104C-Myb DNA-Binding Domain
1msf_C1e-38181193104C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001622G0290
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0928080.0FP092808.1 Phyllostachys edulis cDNA clone: bphyem205d01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020146152.11e-136transcription factor MYB44-like
SwissprotO231608e-84MYB73_ARATH; Transcription factor MYB73
TrEMBLA0A3B6LKC51e-139A0A3B6LKC5_WHEAT; Uncharacterized protein
STRINGTraes_5BL_486D0D865.11e-140(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.12e-64myb domain protein 70
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]