PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001565G0340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 678aa    MW: 76917.3 Da    PI: 7.1963
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001565G0340genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.3e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  PH01001565G0340  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-10103145348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  PH01001565G0340 103 EWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 145
                      7*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
SuperFamilySSF466891.87E-13460IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-16559IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF002497.4E-12853IPR001005SANT/Myb domain
CDDcd001676.45E-121053No hitNo description
PROSITE profilePS5129415.49496149IPR017930Myb domain
SuperFamilySSF466891.79E-1197150IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-1198146IPR009057Homeodomain-like
CDDcd116592.85E-2799148No hitNo description
SMARTSM007172.7E-11100147IPR001005SANT/Myb domain
PfamPF139212.0E-9104152No hitNo description
PfamPF118312.5E-49448675IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKV  60
NHWLSLSADF VCSLPLQSIK NLLVNEGSYL FENVSWSNID ETEWTREEDE KLLHLAKLMP  120
TQWRTIAPIV GRTPSQCLER YEKLLDAACA KDENYEPNDD PRKLRPGEID PNPESKPARP  180
DPVDMDEDEK EMLSEARARL ANTRGKKAKR KAREKQLEEA RRLASLQKRR ELKAAGIDTR  240
HRKRKRKGID YNAEIPFEKR PPPGFYDTVG EDRPLEHVQF PTTIEELEGK RRVDIEAQLR  300
KQDIARNKIL QRQDAPAAIM QANKLNDPEA VTKRSKLMLP PPQISDHELE EIAKMGNAGD  360
PALAEELGEG STATRTLLAS YSQTPRLGMT PLRTPQRTPA GKGDAIMMEA ENLARLRESQ  420
TPLLGGDNPE LHPSDFSGVT PRKKEILTPN PMATPLASPG PGVTPRIGMT PSRDGNSFGL  480
TPKGTPFRDE LRINEEMEMQ DSAQLELRRQ AELRKSLRSG FASISQPKNE YQIVMPPITE  540
EETEEAEEKI EEDMSDKLGR ERAEEQARQE ALLRKRSKVL QRSLPRPPAG SVEILRQSLI  600
KGGESRSRST FVPPTSLEQA DELINEELLR LLEHDNAKYP LDEKTQREKK KGNKRQANGA  660
AFVPEIEDFD VDELKEV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5mqf_L0.026423593Cell division cycle 5-like protein
5xjc_L0.026423593Cell division cycle 5-like protein
5yzg_L0.026423593Cell division cycle 5-like protein
5z56_L0.026423593Cell division cycle 5-like protein
5z57_L0.026423593Cell division cycle 5-like protein
5z58_L0.026423593Cell division cycle 5-like protein
6ff4_L0.026423593Cell division cycle 5-like protein
6ff7_L0.026423593Cell division cycle 5-like protein
6icz_L0.026423593Cell division cycle 5-like protein
6id0_L0.026423593Cell division cycle 5-like protein
6id1_L0.026423593Cell division cycle 5-like protein
6qdv_O0.026423593Cell division cycle 5-like protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1227246KRRELKAAGIDTRHRKRKRK
2241246RKRKRK
Functional Description ? help Back to Top
Source Description
UniProtComponent of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001565G0340
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6629630.0AL662963.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0020I02, complete sequence.
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020198485.10.0cell division cycle 5-like protein isoform X1
RefseqXP_020198486.10.0cell division cycle 5-like protein isoform X2
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A3L6T5B90.0A0A3L6T5B9_PANMI; Cell division cycle 5-like protein
STRINGONIVA04G06780.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44163553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Li S, et al.
    MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis.
    Plant Cell, 2018. 30(2): p. 481-494
    [PMID:29437988]